KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107293465Help
Entry
107293465         CDS       T05763                                 

Gene name
MARS
Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00450  Selenocompound metabolism
pmur00970  Aminoacyl-tRNA biosynthesis
pmur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    107293465 (MARS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107293465 (MARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pmur01007]
    107293465 (MARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pmur03016]
    107293465 (MARS)
Enzymes [BR:pmur01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     107293465 (MARS)
Amino acid related enzymes [BR:pmur01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   107293465 (MARS)
Transfer RNA biogenesis [BR:pmur03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    107293465 (MARS)
 Prokaryotic type
   Other AARSs
    107293465 (MARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 tRNA-synt_1 GST_C_2 GST_C_3 GST_C GST_N_3 GST_C_6
Motif
Other DBs
NCBI-GeneID: 107293465
NCBI-ProteinID: XP_015678102
Position
Unknown
AA seq 914 aa AA seqDB search
MSGPASLHQLGTKRGWEAEGGRNMKLCLSEGSLGGLKVLAAAKATGAPVELRWLPQEAHV
VPFLTRPQLPALQLENGSFLFSTNVISQYFFRLSGKEMSSFSNEHSDFANQFFEWDITEL
EPALSAALYLHVVQEKKGEDILGIIRKPLDYLDQIFTKKGTSYLTGDVESAADIVLWGSL
FPLLRDDSFLPNELKALRSWFQNMNLKEHCRKAVESVWTPKGLLELKAYLQKHPAPSLAF
EQSATNEAKEEESVQQHLSDVEIEAIAEIWSRGPASLPSPWKPQHPVLPVEGMKNVLITS
ALPYVNNVPHLGNIIGCVLSADTFARYCRLRNWNTLYICGTDEYGTATETKAMEEGLTPQ
QICDKYYSIHAQIYQWFNISFDYFGRTTTAQQTTIAQSIFQQLLERKYLLTETVDQLKCE
KCARFLADRFVEGICPFCNYEEARGDQCDKCGKLINATELKKPMCKICQGTPVVKSSQHL
FLDLPKLEESLEKWLAVSQSSGDWTPNSRYITRSWIRDGLKPRCITRDLKWGTSVPLDGF
REKVFYVWFDAPIGYLSITANYTDQWEKWWKNPEQVQLYNFMAKDNVPFHSVVFPCSLLG
TGDNYTLVNHLIATEYLNYEDGKFSKSRGVGVFGDMAKDTGIPADIWRFYLLYLRPESQD
SAFSWNDLMIKNNSELLNTLGNFINRAGTFVCKFFGGCVPAMDLTQDDKRLLAHITLELR
QYNQLLEKVKIRDALRSILNIARHGNQYLQVNEPWKCIKGSDADKKRASTVIGLAVNIAS
LLSVVLQPYMPTVSAAIQDQLCIASSFNVVTNDFVCTLPAGHQIGTVTPLFQKLEAEQIE
NLRKRFSGGQQKAAANIQKTLGGKEHQDGDKRGNKVKHTKAQGAGKEQVDAVVSELVELQ
KQHSVVEGKGKKKK
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaccggcttcgttgcatcagctggggacgaagcgtggctgggaggcagaggga
ggacggaacatgaagctgtgcctgagcgaaggcagccttggtgggctgaaggtcttggcg
gctgccaaagccactggcgcgccggtggagttgcggtggcttccgcaagaggctcatgta
gtcccattcctcacccgtccacagctgccagctttacagctggaaaatggatccttcctc
ttctccacaaatgtaatttctcaatactttttccgcttatctggaaaagaaatgagcagt
tttagcaacgagcacagtgattttgccaatcagttttttgaatgggatataactgagcta
gagcctgctttgtctgcagccttgtatcttcatgtggtacaagaaaagaaaggagaggat
attttgggcatcatccggaagccactggactaccttgaccagatttttaccaaaaagggt
acctcttacctcactggggatgttgagtcagctgctgatattgtcttatggggatctctg
tttcctctgttaagagatgactccttcttaccaaatgagctgaaagctctgaggagttgg
ttccagaacatgaacttgaaggaacactgcagaaaggcagtggaatctgtatggacaccc
aagggattgctggaacttaaagcctacctacagaaacatcctgctcccagtttggctttt
gagcaatcagctaccaatgaagccaaggaagaggaatcggtccagcagcatttgtctgac
gtggagattgaagccattgctgaaatctggagcagaggaccagccagccttcctagcccc
tggaaaccacagcaccctgtattgcccgtggaaggcatgaagaatgtgctaatcacgagt
gcgctgccctatgtaaacaatgtgcctcatcttggaaatatcattggctgcgttctcagc
gctgatacctttgccaggtactgtcgcctacgcaattggaacaccctctatatatgcggt
actgatgaatatggtactgccacagagacaaaggccatggaggaaggactgacaccacaa
cagatctgcgataaatactattctatccatgcacaaatctaccagtggttcaacatctct
tttgactattttggtcgcaccaccacagcccaacagactacaatagcgcaaagcatcttc
caacagttgctggagcgcaagtatcttctgaccgagacagtggaccagttgaagtgtgag
aaatgtgcgagattcctagcagaccgctttgtggaaggcatctgccctttctgcaactat
gaagaagcccgtggagatcagtgtgacaaatgtggcaagctcataaatgccactgaactt
aagaaaccaatgtgcaaaatctgccaaggaaccccagtggtgaaatcttctcagcacctc
ttcctggatctacccaagttagaagagagtctggagaaatggttggctgtgtcccagtcc
agtggggattggacccccaactcaagatacatcacccgctcctggatccgggatggcctc
aagccacgttgtatcactcgtgacctgaagtggggcacatcagttccacttgatggcttc
cgtgagaaggtattctatgtttggtttgatgctccaattggctatctgtccatcacagct
aattacaccgaccagtgggagaaatggtggaagaacccagaacaggttcagctttataac
ttcatggccaaggataacgttcccttccacagcgttgtgtttccttgctcattgctgggc
accggtgataattacactctggtcaaccatctaattgcaacagaatatttgaactatgag
gatggcaaattctccaaaagccgtggtgtgggagtttttggggatatggccaaagacaca
ggcattcctgcagatatctggcgcttttatctgctctacttgcggccagagagccaagat
agtgccttctcttggaatgatctgatgatcaaaaacaactccgagctgctgaataccctc
ggcaattttatcaatagagcaggaacttttgtgtgcaaattcttcgggggttgcgtccct
gcgatggacttaacccaggatgacaagcgcttgttggctcacatcacgttggaactgcgg
caatacaaccagttgttggagaaggtcaagattcgtgatgccttacgcagcatcttgaat
attgctcgccatggcaaccagtaccttcaggtcaatgagccctggaaatgcatcaaaggc
agtgatgcagataaaaaacgggcaagcactgtgatagggctggctgtcaacattgcaagc
ttgctgtcagttgtgttgcaaccttacatgcccactgtgagcgctgcaatccaggaccag
ctgtgcattgcatccagctttaatgttgtgaccaatgacttcgtctgcaccctgccagct
ggacatcagattggcacggtgactcccttgttccaaaagttggaggctgaacaaattgaa
aacttgcgaaagcgttttagtggaggacagcaaaaagcagctgcaaatatccagaaaaca
ttgggagggaaggaacatcaggacggagacaaacggggtaacaaggtaaaacacacaaag
gcccagggtgctggaaaagagcaagttgatgctgtggtctcagagttggtggaactgcag
aagcaacacagtgtggtagaaggaaaagggaaaaagaaaaagtga

DBGET integrated database retrieval system