KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107293628
Entry
107293628         CDS       T05763                                 

Gene name
ACY3
Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming)
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107293628 (ACY3)
Enzymes [BR:pmur01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     107293628 (ACY3)
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 107293628
NCBI-ProteinID: XP_029141267
Position
Unknown
AA seq 311 aa
MSHPQYLPPLRRVAICGGTHGNEMSGVYLVKHWLQDPSDLQRSTFQVTPLVGNPRAVERC
VRYIGRDLNRTFAAAFLNTKASDSDLYEIQRAQEINQIFGPKGSSQAYDFMLDLHNTTAN
MGSCLLLKSEFSLLSIHMCNYIQKHCRVRHCPILLCQISGEDTTFMTSVAKHGLALELGP
QPQGVARADQLAKMRSIVVCALDFIELFNKGTLFPAFEIEAYRPVEQKDFPRYPNGEISA
VIHPNLQDKDFQPLKPGDPVFQNLDGEDILHDGDDTFFPVFINEAAYYEKKIAFWKTKKE
TFTQPALQKTF
NT seq 936 nt   +upstreamnt  +downstreamnt
atgtcacacccacaataccttcctcccttgagacgggtagcaatatgcgggggaactcat
gggaatgaaatgtcaggtgtttacctagtcaagcactggctacaggatccatccgatttg
cagcgcagcacctttcaggttacacctcttgtgggcaacccgcgtgcagtcgagcggtgc
gtgcgctacattgggagggatctcaatcgtacgttcgctgcagcttttctaaataccaag
gcttcagattcagacctttatgagattcaacgtgctcaggaaatcaaccagatcttcgga
cccaagggctcatctcaagcctatgactttatgttagatctacacaacactacagccaac
atgggttcctgcctcttactgaagtctgaatttagcctgttatccatacatatgtgtaac
tacatccagaaacactgcagagtgagacactgtcccatcttactctgtcaaatatctgga
gaggacactactttcatgacgtcagtggctaaacatggactagcattagagttgggccca
caaccccagggagtggcacgagctgaccaacttgctaagatgagatcgattgtggtctgt
gctttggacttcattgagctttttaacaaaggcaccttgttcccagcttttgaaattgag
gcatacagaccggttgaacagaaggacttcccccgttatcccaatggggagatttctgct
gtaatacatccaaatctacaggataaagatttccagcccctgaagcctggggacccagtt
ttccagaatttggatggggaggatattctgcatgatggtgatgacaccttcttcccagtc
ttcatcaatgaagcagcctactatgagaagaaaatagccttttggaagacaaaaaaggaa
acatttacacaaccggcactgcagaagacattttaa

DBGET integrated database retrieval system