KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107293669Help
Entry
107293669         CDS       T05763                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 proprotein
  KO
K13376  transforming growth factor beta-2
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04010  MAPK signaling pathway
pmur04060  Cytokine-cytokine receptor interaction
pmur04068  FoxO signaling pathway
pmur04110  Cell cycle
pmur04218  Cellular senescence
pmur04350  TGF-beta signaling pathway
pmur04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107293669 (TGFB2)
   04350 TGF-beta signaling pathway
    107293669 (TGFB2)
   04068 FoxO signaling pathway
    107293669 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107293669 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107293669 (TGFB2)
   04218 Cellular senescence
    107293669 (TGFB2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107293669 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pmur04052]
    107293669 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:pmur00536]
    107293669 (TGFB2)
Cytokines and growth factors [BR:pmur04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   107293669 (TGFB2)
Glycosaminoglycan binding proteins [BR:pmur00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107293669 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 107293669
NCBI-ProteinID: XP_015678318
Position
Unknown
AA seq 412 aa AA seqDB search
MHCYLLSVFLTLDLATVAFALSTCSTLDTDQFMRKRIEAIRGQILSKLKLTSPPEEYPEP
EEVPPEVISIYNSTRDLLQEKANHRAASCEKERSDEEYYAKEVYKIDMGSYYPSANFIST
SNQNPYFRRVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVSEQRIELYQMIKNKDPTSP
TQRYIDSKVVKTRAEGEWLSFDVTEAVHEWLHHKDRNLGLKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDDHPYSSGEKALKSSRKKYSGKSPHLLLMLLPSYRLESQQSSRRKKR
ALDAAYCFRNVQDNCCLRPFYIDFKKDLGWKWIHEPKGYHANFCAGACPYLWSSDTQHSR
VLSLYNSINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcactgctatctcctgagcgtgttcctcaccctggatctggccacggtggcctttgcc
ctgtctacgtgcagcaccctagacacggaccagttcatgcgtaagcggatcgaagcgatc
cgaggccagatcctgagcaaactgaaactcaccagccctccggaagagtaccccgagccc
gaggaggttcctccggaggtcatctcaatctacaacagcacgagggacttgctgcaggag
aaggcgaaccacagggcggcctcttgcgaaaaggaaaggagcgatgaggaatattacgcc
aaagaagtttacaaaattgacatggggagttactacccgtcggcaaatttcatctcaaca
agcaatcaaaacccatattttagaagagtgaggtttgatgtctcagcaatggagaaaaat
gcttccaacttagtgaaagcagaatttagagtcttccgcttacagaatccaaaagctcgt
gtatcagaacaacggatagaactgtatcagatgatcaaaaacaaagatcccacatcacct
acacaacgctatattgatagcaaggtcgtgaaaacaagagctgagggtgaatggttatca
tttgatgtaactgaggctgtacatgaatggctccatcacaaagacaggaatttgggactt
aagatcagtttacattgtccgtgctgtacatttgtgccttcaaataattatattatccca
aacaaaagtgaagaattagaggcaagatttgcaggtattgatgaccacccttattccagt
ggtgagaaagctttaaagtcgagtaggaaaaaatacagtgggaagagcccacatcttctg
ctaatgttattaccctcctacagacttgagtcgcaacaatccagtcggcggaagaagcgt
gctttagatgctgcttattgttttaggaacgtgcaagataactgctgtctacgtccattt
tatattgatttcaagaaagatcttggatggaaatggatacatgaacctaaaggatatcat
gcaaatttctgtgcaggagcttgtccctatttatggagctcagacactcagcacagtaga
gtgcttagcttgtataactcaatcaacccagaggcatctgcatctccatgttgtgtatct
caggatctggaacccctcactatcttgtattacattggcaaaacacccaaaattgaacag
ctttcaaatatgattgtaaagtcttgcaagtgcagctaa

DBGET integrated database retrieval system