KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107294622Help
Entry
107294622         CDS       T05763                                 

Gene name
HCFC2
Definition
(RefSeq) host cell factor 2
  KO
K14966  host cell factor
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107294622 (HCFC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pmur01009]
    107294622 (HCFC2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pmur03036]
    107294622 (HCFC2)
   03029 Mitochondrial biogenesis [BR:pmur03029]
    107294622 (HCFC2)
Protein phosphatases and associated proteins [BR:pmur01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107294622 (HCFC2)
Chromosome and associated proteins [BR:pmur03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     107294622 (HCFC2)
   HMT complexes
    COMPASS/SET1 complex
     107294622 (HCFC2)
    MLL-HCF complex
     107294622 (HCFC2)
Mitochondrial biogenesis [BR:pmur03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    107294622 (HCFC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_5 Kelch_1 Kelch_3 Kelch_4 Kelch_6 Kelch_2 fn3 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 107294622
NCBI-ProteinID: XP_029141489
Position
Unknown
AA seq 761 aa AA seqDB search
MAAGAAALNWRRVSSFTGPVPRSRHGHRAVAIRELVIIFGGGNEGIADELHVYNTATNQW
FLPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNDLYELQASRWLWKKMRPQPPS
AGLPPCPRLGHSFCLYGNKCYLFGGLANESEDSNNNIPRYLNDFYELELQHGSGVLGWGI
PLTRGVLPSPRESHTAVIYCKKDLGNPKMFLFGGMSGCRLNDLWELDIETMTWSKPETKG
TVPLPRSLHTASVIGNKMYIFGGWIPQSTDESLPAQDGEWKCTGSFSYLNLDTLEWINLI
PDCQEDKNNLLPGPRAGHCTVIVGSRLYIWSGRDGYRKAWNNQVCCKDLWYLDTEKPPAP
SQVQLIRATTNSFQVKWDEVPTVEGYLLQLNLDMSTPGAADISFTVTPEPQSSCVQGTKL
DLHPQTLSASSNVQISISEAKAKIPETENMKKNHSVSKEPSVPLCLPASTLANLNELLDF
DSRTSQVDTSTSSIATTTQNIVTQQAVRTNSSNGAAAKDETPLLTTVKESPVASTRVTVI
NPLDSAVQSPKTSPPKQNARIRTQERKWYDVGIFQSNTALVSQFYLLQEEKVLSSKGDYT
DIPNASLFKKQDLAPGTLYRFRVAAINGCGVGPFSKISEFKTCIPGFPGAPSIVKISKSA
DCIHLSWEPPVSPSGNILEYSAYLAIRTTQLHENPNQLMFMKIYCGLKTSCTVTAAQLAN
AHVDHTSKPAIVFRISAKNERGYGPATQVRWLQEMKTSSSK
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaggcgccgctgccctgaattggaggcgcgtttcttccttcacggggccggtc
ccccgatcccggcatggccatcgcgccgtggcgatccgcgagctggtcatcatctttggg
ggcggcaacgaaggcatcgccgatgagctgcatgtgtacaacacggccacaaaccaatgg
tttcttcctgctgtcagaggagatattccaccaggttgtgcagcccatggatttgtctgt
gatggtaccagaatattagtttttggaggaatggttgaatatggaagatatagtaatgat
ttgtatgaactacaggcaagtcgatggctgtggaaaaaaatgagacctcagcccccttca
gcaggtttgcctccatgccctcgccttggccatagcttctgtctgtatggcaacaagtgt
tacttatttggtggactggcaaatgagagcgaagactcaaacaataacattcccagatat
ttaaatgatttctatgaattggagctgcagcatggatcgggagtcctaggctggggtatt
ccattgaccagaggagttttgccctctcccagagaatcgcacacagctgttatatactgt
aaaaaagacttgggaaatccaaaaatgtttctatttggagggatgtctggttgccggctt
aatgacctttgggagcttgatatagagacaatgacttggtcgaaaccagaaactaaagga
acagtgccacttccccgtagtctacatacagccagtgtaataggaaacaaaatgtacatt
tttggtggatggatcccacagagtacagatgagagcctccctgctcaagatggggaatgg
aaatgtactggttcattttcctacttaaatttagatactttagaatggataaatctaatc
ccagattgccaagaagataaaaacaatttgttaccaggtccaagagctggccactgcaca
gtcattgtcggctctcgcttgtatatatggagtggcagagatggctataggaaagcttgg
aacaatcaagtttgctgcaaggatctttggtatttagatacagagaaaccaccagcacca
tcacaggtacagctcatcagagctacaactaattcatttcaagttaaatgggatgaagtt
cctactgttgaaggataccttcttcaactaaatttagatatgtcaacacctggtgcagct
gacatatcctttactgtgacacctgaaccacaatcatcctgtgtgcaaggaactaaactg
gatctccacccccaaactctcagtgcctcaagcaatgtgcaaatttccatttcagaggct
aaagccaagattccagaaactgaaaatatgaagaaaaaccattccgtttccaaagagccc
agtgtccctttatgtttgcctgctagcactttagcaaatctaaatgaattacttgacttt
gattcaagaacttcccaagtagatacttctacatctagcatagccaccaccacacaaaat
atagtaactcagcaggctgttagaaccaactcatcaaatggggcagctgcaaaagatgaa
actccattattaacaacagttaaagagtctccagtggcctcgactagagtcacagttatt
aacccacttgattcagctgtacaatcgcctaaaacttcaccaccaaagcagaatgcaaga
ataaggacacaagaacgaaagtggtatgatgttggcatttttcaaagcaacactgcatta
gtgagccagttttatttgctgcaagaagaaaaagttctttccagcaagggagactataca
gatattccaaatgccagtttgtttaagaaacaggatctcgctcctggcactttatacagg
ttcagggttgctgcaattaatggatgcggtgtaggacctttcagcaaaatcagtgaattt
aaaacttgcatccctggatttcctggagcaccttcaatcgttaaaattagcaagagtgca
gactgtattcatctttcatgggagcctccagtttcaccttcaggaaatattttggaatat
tccgcttatttggcaataagaaccacccagctccatgaaaatcctaatcaacttatgttc
atgaaaatctattgtggccttaagacctcatgcacagtgactgctgcccagcttgcaaat
gctcatgttgatcatacatccaagcctgccattgtgttcaggatttcagccaagaatgag
aggggatatggaccagccacacaggttcgatggctgcaagaaatgaaaacatcaagctca
aagtag

DBGET integrated database retrieval system