KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107294926
Entry
107294926         CDS       T05763                                 

Gene name
RDH5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    107294926 (RDH5)
Enzymes [BR:pmur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     107294926 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 107294926
NCBI-ProteinID: XP_015679681
Position
Unknown
AA seq 319 aa
MWCCILLFSVVWAVVWFFRDQQTLSNFRDKYVFITGCDTGFGNMLAKKLDKKGFRVLAGC
LTQKGADNLDRTSSSNLRTTLIDVTSSESICKAVEWVKAEVGRKGLFGLVNNAGLGSSIG
PTEWMTVEDYRKVMSVNTFGMIEVSLAFLPLLKQARGRVVNVSSVLGRVSANGGGYCISK
YTVEAFSDSLRRDMYHFGVKVSIVEPGFFKTAMTNLETIEVALRHNWDRMSPEAQRSYGE
DFFHNYLKVQKFIMNIVCDSDLSKVTNCMEHALQAKHPRSRYSAGWDAKFLWLPISYLPS
FLVDISLSIILPKPAQRVR
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtggtgctgcattctactcttcagtgtagtttgggctgtggtctggttcttccgtgac
cagcagactttgagcaacttcagagacaagtatgttttcatcacgggttgcgacacgggt
tttgggaacatgctagccaaaaaacttgacaaaaagggtttccgagtgctggcaggctgc
ttgactcagaaaggagctgataacttggaccgcaccagctcgtcaaacctgcgcaccaca
ctgattgatgttaccagctccgaaagcatctgcaaagcagtggaatgggtgaaagctgaa
gtgggtcgaaaaggactctttggtctggtgaacaatgcaggtttaggcagctctattggc
cccacagaatggatgaccgtggaagactaccgcaaagtcatgtctgttaacacctttgga
atgatcgaggtatcattggccttcctgccattgctcaagcaagcccgtggccgagtagtc
aatgtttccagcgtcctggggcgggtttcagccaatggtggtggctactgcatttccaaa
tatacagtggaggccttttccgacagcctcaggagggacatgtatcatttcggggtaaaa
gtctccattgtagagccaggctttttcaaaacagccatgactaatcttgaaacaatagag
gttgccctgcggcacaactgggaccgaatgagccctgaagcccagcggagctatggtgaa
gatttctttcacaattacttgaaagtccagaaattcatcatgaacatcgtctgtgattct
gacctcagcaaagtgacaaactgcatggagcacgcccttcaagctaagcaccctcgctct
cgttacagtgcaggatgggatgctaagtttctgtggctgccaatctcttatctaccttcc
tttttggtggatatttccctgtctatcatcttaccaaagccagctcagcgggtgcgctaa

DBGET integrated database retrieval system