KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107295998
Entry
107295998         CDS       T05763                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00100  Steroid biosynthesis
pmur01100  Metabolic pathways
Module
pmur_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    107295998 (TM7SF2)
Enzymes [BR:pmur01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     107295998 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 107295998
NCBI-ProteinID: XP_029141790
Position
Unknown
AA seq 419 aa
MDRLKVPRTKELEFGGVFGVALLMVLMPSTVFYLLLVCRTEQASVLSPPLPLPSFRSLWS
PQDFALVLTWVAFQALLYQLPMGKLSEGSVLRDKSRLQYRINGFYTMLVTALMVGAGLAG
GLRLSYIYDHLLQLAFAATVVAFSLSVLLYFKALLAPETALAPSGNSGNPIYDFFMGHEL
NPRIGVFDLKFFCELRPGLLGWALINMAMLVKETELRGSPSLAMILVNAFQLLYVVDAFW
HEEAILTTMDIVHDGFGFMLAYGDLAWVPFLYSLQSCFLVAHPQQLSLPLAGGIVLLNGE
SITIFRGANSQKNTFRRNPADPRVTGLRTIPTATGRRLLVSGWWGFVRHPNYLGDLIMAF
AWSLPCGFTHILPYFYIIYFTLLLAHRDARDEHQCLRKYGLAWHEYCRRVPYRIFPYLY
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggatcgactgaaggttcctcggactaaagaactggaatttgggggtgtatttggagtg
gccctcctgatggtcctgatgcccagcactgtcttctacctgctgctagtctgcaggacg
gagcaagccagcgtgctgagcccccccttgccgctgccctcctttcgctccctctggagc
ccccaagacttcgctctggtcctgacctgggtggcattccaagcccttctctaccagctg
ccaatggggaagctcagcgaaggaagtgttcttcgggacaagagccggctgcaatatcgc
attaacgggttctacaccatgttggtcacagcgctgatggtgggtgccggactggccggg
gggctgcgcctgagttacatctacgaccacctcctgcaactggccttcgcagcgaccgtc
gtggctttcagcctgagcgtccttctctattttaaagctctgctggccccagagacagct
ctggctcccagtgggaattcaggaaaccccatttatgacttcttcatgggccatgagttg
aacccacgcatcggggtctttgatctcaaattcttctgtgagttacgcccaggtctcctt
ggctgggccctgatcaacatggcgatgttggttaaagaaacggaactgagaggcagcccc
tccttggccatgatcctggttaatgccttccagcttctctacgtggtggatgccttctgg
catgaggaggccattctcaccacaatggatattgtccatgatggcttcggtttcatgctt
gcttacggggacctggcttgggtgccattcctgtacagcctccagtcctgcttcctcgta
gctcacccccagcagcttagcctgcctctagcggggggcatcgtcctgctaaatggtgag
tctataaccatattccgtggtgccaattcccagaaaaacaccttccgacggaatcccgct
gaccccagagtgactgggctccggacaatccctacggcaaccggtcgccgcctcctggtc
tctggctggtggggttttgtgcgacaccccaactatttaggagatctgatcatggctttt
gcgtggtctttgccctgcggattcactcacatcttgccctatttttatattatctatttc
accttgctgctggctcatcgggatgcccgggacgagcaccagtgcctgaggaagtacggg
ctagcgtggcacgaatattgccggcgtgtcccttaccggattttcccgtatctctactga

DBGET integrated database retrieval system