KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107296781Help
Entry
107296781         CDS       T05763                                 

Gene name
ENTPD8
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 8
  KO
K01510  apyrase [EC:3.6.1.5]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00230  Purine metabolism
pmur00240  Pyrimidine metabolism
pmur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107296781 (ENTPD8)
   00240 Pyrimidine metabolism
    107296781 (ENTPD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pmur04090]
    107296781 (ENTPD8)
Enzymes [BR:pmur01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     107296781 (ENTPD8)
CD molecules [BR:pmur04090]
 Proteins
  107296781 (ENTPD8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39
Motif
Other DBs
NCBI-GeneID: 107296781
NCBI-ProteinID: XP_015681618
Position
Unknown
AA seq 390 aa AA seqDB search
MGSKWNSWYLRGGLTLLGIFSLTALILSLVRIHSTTQPSENKYGLVFDAGSSHTSLFVYQ
WPEEKENDTGMVSQMFSCNVKGPGISSYTSNPPQAGGSLRECLNAAMRVIPPERQQESPV
YLGATAGMRLLRMQNESAAAQILEAVSQTIQKYPVNFQGARIISGKEEGAFGWITINYLL
NSFTQYSAKDRGWIRPPSANILGALDLGGASTQISFIPAGPIADPSEALQFRLYGFDYTI
YSHSYLCYGQNEAFQRVIRLILDGPAGVEVGHPCYPKGYEEIVQRASLSSNPCTKPLPPT
ASSGNVTLVGNGNVTLCREKLKAIFNFSGCRDPSSCGFEGTYQPRVNGKFLAFSAYYYTF
RFLNLTVTSPLATVERAIQIFCARTWKDGN
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgggctccaaatggaacagctggtatctccgtggaggtctgactcttttgggtatcttt
tctctgactgctctgatcctcagcttggtgagaatccacagcaccacacaaccttctgag
aacaagtatggcttggtgtttgatgcgggttcatcccacacgtccctctttgtataccag
tggccggaggagaaggaaaacgatacgggcatggttagccagatgttctcctgcaatgtc
aaaggacctggaatctcaagctacaccagtaaccctccacaggctggtggttctctgcgg
gaatgtctgaatgcagcaatgagagttatccctccagaaagacagcaagagtcaccagtt
tacttgggagctacagcaggcatgagactgctcaggatgcagaacgagtcagctgcggcg
cagattttggaggcggtctcgcaaacgatccagaaatatcccgtgaatttccaaggggct
cgaattatcagcgggaaagaagaaggggcctttggctggatcaccatcaactatctgctg
aactctttcacacagtactctgcaaaagaccgaggctggatccgtcctccctcagccaat
atcctgggagccctggacctcgggggagcctccacccagatcagcttcatcccggctggt
ccgatcgcagatccatccgaagccctgcagttccgcctctacggcttcgactacaccatc
tatagccacagctacctctgctacggccaaaacgaagccttccagcgggtgatccggttg
atccttgatggacctgccggcgttgaggtgggtcatccctgctacccaaaaggctacgaa
gaaatagtacagagggcatccctctctagcaacccctgtaccaagcctctccccccaacc
gcatcttcggggaacgtaactctggtgggcaacgggaacgtcacgctatgccgggaaaag
ctcaaagcgatcttcaacttctccggctgtcgagacccatcatcctgcggctttgagggg
acctaccagccgagagtcaacgggaagtttctggccttttctgcgtattactacacgttc
cgctttttgaacctgacagtcactagtccactggccactgttgagagagccatccagatt
ttctgtgccagaacatggaaagatggaaactga

DBGET integrated database retrieval system