KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107297025Help
Entry
107297025         CDS       T05763                                 

Definition
(RefSeq) lysosomal acid glucosylceramidase-like
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00511  Other glycan degradation
pmur00600  Sphingolipid metabolism
pmur01100  Metabolic pathways
pmur04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107297025
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    107297025
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107297025
Enzymes [BR:pmur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     107297025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30
Motif
Other DBs
NCBI-GeneID: 107297025
NCBI-ProteinID: XP_015681866
Position
Unknown
AA seq 115 aa AA seqDB search
ATGSRACIPKYFGDHAVVCVCNSTYCDTQDPVSLPPLGQFVVYESSKSGNRLERREGYFQ
KPTAKPDTLLILETAQRYQRIKGFGGSVTDAASINILALSPNTQKNLLRSYFSEE
NT seq 346 nt NT seq  +upstreamnt  +downstreamnt
gcaacgggaagccgagcttgcatcccgaaatattttggcgaccacgctgttgtgtgcgtt
tgtaacagcacgtattgcgacacgcaagatcccgtctctctcccccctttgggtcagttt
gtggtgtatgaaagcagcaaatctgggaaccggctggaacgccgagaaggctattttcag
aagccgacggccaaaccagatactcttctgattttggagacggcccagcggtatcagaga
ataaaaggatttggggggtccgtcactgatgcagcctccatcaacatcctggctctgtcg
ccgaacacccagaaaaatctactccgttcctacttctcggaggaag

DBGET integrated database retrieval system