KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107297246Help
Entry
107297246         CDS       T05763                                 

Gene name
ENTPD2
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 2
  KO
K01509  adenosinetriphosphatase [EC:3.6.1.3]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00230  Purine metabolism
pmur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107297246 (ENTPD2)
Enzymes [BR:pmur01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     107297246 (ENTPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39
Motif
Other DBs
NCBI-GeneID: 107297246
NCBI-ProteinID: XP_015682095
Position
Unknown
AA seq 500 aa AA seqDB search
MSPKQAVVAALGALCLVAVAGLVLLCVPTKDVLDPPAFKYGIVLDAGSSHTAMFVYKWPS
DKENETGIVSQHSDCHVKGEGISKYSTNPPAAGESLIACLDQALEDVPKARHAITPLYLG
ATAGMRLLNISNPQASGSVLEAVTSTLKKYPFDFRGARILSGEDEGLFGWVTANYLLENF
VKYGWIGQWIRPKKTTVGAMDLGGASTQITFETTGAIESPANEVTLKLYGQRYKVYTHSY
LCYGMNEVLNRLISKVLKAKAYALRLENPCWPQGFKHSFPMESIYGSPCASTEKPLNYFP
TATVNMSGSGDPAQCMAHAESLFRFTGCTYSSCSFDGVFQPPVEGNFIAFSAFFYTVDFL
RSVMKRQVATPNDLKDATEALCSTPWSELLKKAPKLELHLQNYCSMATFVSLLLSRGYSF
GNTTFPSVSFQKKAGDTTIGWALGYMLNLTNMIPAEEAGFRKGTSFGPWVGLIFLFVAIL
LGSLISLFCLLKASKGHGGV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagccccaagcaggcggtggtggcggcgctgggcgcgctgtgcctggtggccgtggcg
ggactcgtcctgctctgcgtgcccaccaaggacgtgctggacccgcccgccttcaagtat
gggatagtgctggacgcagggtcttcccacacggccatgtttgtctacaaatggccgtcg
gacaaggagaacgagaccgggattgtcagccagcacagcgactgccacgtgaagggggaa
ggcatctcaaagtactccacgaacccaccggcagccggggaaagcttgatagcctgcctt
gaccaggccctggaggacgtcccgaaggcgaggcacgccatcacgcccctctacctgggc
gccacggctggcatgcggctgctgaacatttctaacccccaggcttcaggcagcgtcctt
gaagcggtgacctccacattgaagaaatacccctttgacttccggggagccaggattctg
agtggggaggatgaaggtttattcgggtgggtcaccgctaactacctcctggagaacttc
gtaaagtacgggtggatcgggcagtggatccgtcccaagaagaccacggtgggggccatg
gacctgggcggcgcctccacccagatcaccttcgagaccacgggggccatcgagagcccc
gccaacgaggtgacactgaagctgtacgggcaacgctacaaagtctacacgcacagctac
ctctgctacggcatgaatgaggtcctcaacaggctgatctccaaggtgctgaaggctaaa
gcttacgccctccgactggagaacccctgctggccacagggattcaaacacagtttcccc
atggaaagcatctatgggtcgccctgcgccagcaccgagaagcccctcaactacttcccc
acggccacggtgaacatgagcggctccggggaccctgcccagtgcatggcgcacgcagag
agcctcttccggttcaccggctgcacgtattccagctgctcctttgacggggtcttccag
ccccccgtggagggaaactttatcgccttctctgcatttttctacacggtggatttcctc
cggtcagtgatgaaaaggcaggtagccacaccgaatgacctcaaagatgctacggaagcc
ctctgcagcacgccctggagtgagctgctcaagaaggcaccgaagctggagctccatttg
cagaactactgctcgatggccaccttcgtctccctgctcctcagccggggctactccttc
ggcaacaccaccttccccagcgtatctttccagaagaaggccggggacacgaccatcggc
tgggctctgggctacatgctgaacctcaccaacatgatcccggcggaggaggccggcttc
cggaagggcaccagcttcggcccctgggtgggcctcatcttcctctttgtcgccatcctc
ctgggcagcttaatcagccttttctgcctgctgaaggcctccaaggggcacgggggcgtc
tag

DBGET integrated database retrieval system