KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107297342Help
Entry
107297342         CDS       T05763                                 

Gene name
SERAC1
Definition
(RefSeq) protein SERAC1
  KO
K23504  protein SERAC1
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pmur03029]
    107297342 (SERAC1)
Mitochondrial biogenesis [BR:pmur03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    107297342 (SERAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_6 PGAP1 Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 107297342
NCBI-ProteinID: XP_015682187
Position
Unknown
AA seq 662 aa AA seqDB search
MGRMSLAAYCVVCYRKIGTLGSTWKVDQSWKHIRKIVKLTGSLILGGCIFATYEVLTLRK
LFSFDTQVVQQEKLKSYIYLRTVSLDQSDYQGIIYQVRKKLHRAAKKIIEMHARIFQKPF
DERFSTLDAEERDYALWLLVKRSQSNDKMVRLQAVQELAANRYWHDYQYRTVAQTSDQRT
AVALARCEDVDLRFFLPPHLLLKPKDTCCLEDELRLLLAALPQKDLDQCVQYFTSLALRE
SSQTIAAQKGGLWCFGGNGLPYCESLSTIPAKTVELFCLQALVEHSKIPSHCNKIEANKG
LQLLQKLYHLHRDSRKIQRSIIHIIGNMALDERLHASIIRAGWVSILAAMMKSSRVMESS
HAARALANLDREVLQEKYPEGVYILHPQYRTNTSEPIKADVLFVHGLLGAAFKTWRQQDL
EYSTDDKDMDAEDDYSECWPKTWLASDCPSLRIISVEYDTHLSDWRTKCPVESYRESLAY
RSTELLKKLRAAGIGDRPLIWLSHSMGGLLVKKMLLDASMDPEMASIVDSTRGIVFYSVP
HHGSRLAEYSVNIRFLLFPSVEVKELSKDSPALKALNDDFISFAKNQNFPVLSFAETLPT
RVGRMLSLHVVPVESADLGIGELIQVEVSHLNICKPKNKDSFLYQHTLKFIQDSLKKELG
NQ
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgggcagaatgtctctggctgcttattgtgtggtttgctatagaaagataggaacttta
ggttcaacatggaaagttgatcaatcatggaaacatatcagaaaaattgtgaagttaact
ggctcacttattctgggtggttgtatatttgctacttatgaagttttgactttaagaaaa
ttattcagttttgatacccaagtggtacagcaagaaaaactgaaatcctacatctacttg
cgaacagtttctttagatcaaagtgattatcaaggaatcatatatcaagtgagaaagaag
cttcaccgagcagccaaaaaaattatagaaatgcatgctcgaattttccagaagcccttt
gatgaacgcttcagtacacttgatgcagaagagcgtgattatgccttgtggctgcttgtg
aaaagaagtcaatcaaatgataaaatggtccgattacaagctgtgcaggaattggccgcc
aatcgttactggcatgattatcaatacaggactgttgcccaaacaagcgaccagagaact
gctgttgctttagctcggtgtgaagatgttgatctgcgatttttcctgcctcctcatctt
ttactgaaaccaaaagatacttgttgcttagaagatgaacttcgactgcttttggcagct
ttacctcaaaaagatcttgatcagtgtgtacagtattttacctctttagctttaagagaa
agcagccagaccatcgctgcccaaaagggaggcttgtggtgttttggaggtaatgggctt
ccatactgtgaaagtctcagtaccatacctgcaaagacagtggaactcttttgtttgcaa
gctttagtagaacattccaagattcctagccattgtaataaaattgaagcaaacaaggga
cttcaactcttgcaaaaactgtatcacctccatagagattctcgcaagatacaaagaagt
atcattcacataattggaaatatggcactagatgaacgtcttcatgcatcgataatacgt
gcaggatgggtttctatactggcagctatgatgaagtcttcacgcgtcatggagtcctct
catgctgcaagagccttggctaatctggatagggaagtgctacaagaaaagtatccagaa
ggtgtatacattttacacccacaatatcgaaccaataccagtgagcccattaaagccgat
gtcctttttgttcatggccttttgggagcagcatttaaaacatggagacaacaggacctt
gagtactctacagatgacaaagacatggatgcagaagatgactacagcgaatgttggcca
aaaacttggttagcatctgactgcccatcgcttagaattatttctgtggaatatgatacc
caccttagtgactggagaacaaaatgtcctgtagagagctacagagaatctcttgcatat
cgaagtactgagcttctcaagaaactaagagctgctggcattggagacagacctctcata
tggctgtcgcatagcatgggcggtcttctggtcaagaaaatgctgctggatgcttccatg
gaccccgaaatggcttccatagtggacagcacacggggaattgtattttatagtgttcct
caccatggctcccggttggctgaatattccgtaaatatccgatttctgctcttcccttct
gtggaagtcaaagagctcagcaaagattcgcctgcccttaaagcactgaatgatgacttc
atctcatttgccaagaatcagaactttccagtattaagctttgcggaaactttgccgaca
cgagttggcagaatgctgagtctgcatgtcgtgccagtggaatctgcagatttaggcatt
ggagaactcattcaggtagaagttagccatctcaacatttgtaaaccaaagaacaaagac
tctttcctgtatcaacacaccttaaagtttattcaagattctctaaaaaaggagctggga
aatcagtga

DBGET integrated database retrieval system