KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107297791Help
Entry
107297791         CDS       T05763                                 

Gene name
PC
Definition
(RefSeq) pyruvate carboxylase, mitochondrial
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00020  Citrate cycle (TCA cycle)
pmur00620  Pyruvate metabolism
pmur01100  Metabolic pathways
pmur01200  Carbon metabolism
pmur01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107297791 (PC)
   00620 Pyruvate metabolism
    107297791 (PC)
Enzymes [BR:pmur01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     107297791 (PC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 Biotin_carb_C RnfC_N GCV_H NQRA
Motif
Other DBs
NCBI-GeneID: 107297791
NCBI-ProteinID: XP_015682641
Position
Unknown
AA seq 694 aa AA seqDB search
MGKEKSALAATMRAAAGTRKTNIPFLQNVLSNNQFLHGTVDTQFIDENPDLFHLRPGQNR
AQKLLHYLGHVMVNGPTTPIPVKARPSPIDPVVPAVPLGQPPIGFRDVLLSEGPAGFAKA
VRQHQGLLLMDTTFRDAHQSLLATRVRTHDLKKISPFVAQNFNRLFSIENWGGATFDVAM
RFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNSVFKFCQMAKENGMDIFRV
FDSLNYLPNMLLGMEAAGQAGGVVEAAISYTGDVADPSRTKYTLDYYVSLAEELVKAGTH
ILAIKDMAGVLKPQASSMLVGALRKQFPDVPLHIHTHDTSGAGVASMLACAAAGADIVDV
AVDAMSGMTSQPSMGAMVACTRGTEHDTGIQMEKVFDYSEYWEVARGLYAAFDCTATMKS
GNADVYENEIPGGQYTNLHFQAHSMGLGHKFKEVKKAYVEANKLLGDLIKVTPSSKIVGD
LAQFMVQNNLTQQDVEAQADELSFPQSVVEFLQGYIGIPYGGFPEPFRSKVLKDLPRVEG
RPGASLPPLDFTKLEQELCEKHEEITPEDVLSAAMYPKVFSDFKDFTGTFGPVECLSTRL
FLEGPKIAEEFEEMHFHPKALKDVKGQVGAPMPGKVIDIKVKEGAHVEKGQSLCVLSAMK
METVVNSPVTGTVQKIYVKLGMSLEGDDLIMEIE
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagagaagtctgctctagcagctactatgcgagcagctgcaggtactcggaag
accaacatccctttcctgcagaacgtgctcagtaataatcagttcctccatggcactgtg
gacacccagtttattgatgaaaacccagaccttttccatctgcggcctggccagaacaga
gctcagaagctgctccactacctgggacacgtcatggtaaatggccccaccacgcccatc
cctgtgaaagcccggccttcgcccattgacccggtggtccctgcggttcccttaggtcag
ccccccatcggcttccgggatgtcctcctcagtgagggccctgcggggtttgccaaggcc
gttcgccagcaccagggcctgcttttaatggacaccaccttccgagatgctcaccagtca
ctgctggccactcgtgttcgcacccacgacctgaagaagatctcccccttcgtagcccag
aacttcaacaggctcttcagcatcgagaactggggaggtgccacctttgatgttgccatg
cgcttcctgtacgagtgcccctggcgccggctgcaggagctgcgtgagctcatccccaac
atcccattccagatgctgctgagaggggcgaatgcggtgggctacaccaactacccggac
aactccgtcttcaagttctgccagatggccaaagagaacgggatggacatcttccgcgtc
tttgactccctcaattacctcccgaatatgctgctggggatggaggcagccgggcaggcc
gggggcgtggtggaggccgccatctcctacactggggatgtggctgaccccagccggacc
aagtacaccttggattactatgttagccttgcagaggagctggtcaaagccgggactcac
atcttggccatcaaggacatggctggggtcttgaagccgcaggcctcctctatgcttgtg
ggggcactgcgcaagcaattccccgacgtcccacttcacattcacacccacgacacttcg
ggcgccggcgtggcttccatgttggcttgtgctgctgctggggctgacattgtggacgtc
gcagtggatgccatgtcaggcatgacttcccaaccgagcatgggtgcgatggtggcgtgc
acccgtggcacagagcacgacacaggcatccagatggaaaaagtctttgactacagcgaa
tactgggaggtggcccggggcctctatgcggccttcgactgcacggccaccatgaagtct
ggcaacgcggacgtctacgagaacgagatccccggcgggcagtacaccaacctgcacttc
caggcccacagcatggggctaggccacaagttcaaggaggtgaagaaagcctacgtggag
gccaacaagctgcttggcgacctcatcaaggtgaccccctcctcgaagattgtgggggac
ctggctcagttcatggtccagaacaacttgacgcagcaagacgtggaagctcaagcagac
gagctctccttcccccagtccgtggtggagttcctgcaaggctacatcggcatcccctat
ggaggcttcccagagcccttccgctccaaggtgctgaaagacctgccccgtgtggagggc
cgccccggggcctccctgcctcctctggacttcacaaagttggagcaggaattgtgcgaa
aagcacgaagagatcacccccgaagacgttctgtctgccgccatgtaccccaaagtcttc
agcgacttcaaggacttcacaggcacctttgggcccgttgaatgtctcagtacgcggctc
ttcctggaggggcccaaaatagccgaggagtttgaggagatgcacttccaccccaaagcc
ctgaaggacgtcaaaggccaagtgggagctcccatgccagggaaagtcattgacatcaaa
gtgaaggaaggagcgcacgttgagaagggacaatctctctgcgtcttgagtgccatgaag
atggagaccgtggtcaactcgcccgtgacaggcacggtccagaaaatttatgtcaagctt
ggcatgagcttagaaggggatgatctgatcatggagattgagtag

DBGET integrated database retrieval system