KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107298220Help
Entry
107298220         CDS       T05763                                 

Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-2
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04260  Cardiac muscle contraction
pmur04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107298220
   04261 Adrenergic signaling in cardiomyocytes
    107298220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmur04147]
    107298220
Enzymes [BR:pmur01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     107298220
Exosome [BR:pmur04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107298220
  Exosomal proteins of other body fluids (saliva and urine)
   107298220
  Exosomal proteins of colorectal cancer cells
   107298220
  Exosomal proteins of bladder cancer cells
   107298220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 107298220
NCBI-ProteinID: XP_015683080
Position
Unknown
AA seq 1020 aa AA seqDB search
MGKGTGRESAPPGPTAENGGGKKKQKEKELDELKKEVNLDDHKLSLDEISRKYQVDLSKG
LTNTRAAEILAQDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGALLCFLAYSIQAVME
EEPANDNVSSQAPASAHLPLRGGFSHFQSGFSSKIMDSFKNMVPQQALVIREGEKIQINA
ENVVVGDLVEVRGGDRIPADLRVISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNI
CFFSTNCVEGTARGIVISTGDRTVMGRIASLASGLEVGRTPIAMEIEHFIQIITGVAVFL
GMSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSLTWTALA
RIAGLCNRAVFKAGQDKVPISKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVTEIPF
NSTNKYQLSIHEPEDKPSGNVLVMKGAPERILDRCSTILLQGQEVPLDEELRDAFQNAYL
ELGGLGERVLGFCQFYMPEDQFPRGFKFDADEVNFPLTNLCFVGLMSMIDPPRAAVPDAV
GKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAIRLNIPINQVNPREAKAC
VVHGSDLKDMTPEHLDELLKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSP
ALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSN
IPEITPFLLFIIANMPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPKTDK
LVNQRLISMAYGQIGMIQALGGFFTYFVILAENGFLPTTLLGIRLDWDDRSKNDLEDSYG
QEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETA
LAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLLLRRYPGGWVEKETYY
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagggaccgggcgagagtcggcgcccccgggccccacggccgagaatggcgga
gggaagaagaagcagaaggagaaagagctggacgagctgaagaaggaagtgaacctggac
gaccacaaactctctctggacgagatcagccggaagtaccaggtggatctctccaagggc
ttgaccaacacccgggcagccgagatcctggcccaggacggccccaacgccctcaccccg
ccgcccaccaccccggagtgggtcaagttctgccgccagctgtttggggggttctccatc
ctcctgtggatcggggcccttctctgcttcctggcctacagcatccaggcggtcatggag
gaggagccggccaacgacaacgtgagttcccaggcgccagcgagcgcccatcttcctttg
agggggggtttctctcattttcaatcaggttttagctccaaaattatggactccttcaaa
aacatggtgcctcagcaagccctggtcatccgggaaggtgagaagatccagatcaacgcg
gaaaacgtggtggtgggggatctggtggaggtgcgcggcggggaccggattcctgctgac
ctgagggtgatttcctcccacgggtgcaaggtggacaactcgtccctgacgggtgagtcg
gagcctcagacgcggtccccggagttcacccacgagaaccccctggagacgcgcaacatc
tgcttcttctccaccaactgcgtggaaggcaccgcacgcggcatcgtcatctccaccggg
gaccggaccgtgatggggcgcatcgcctccctggcatccgggctggaggtgggccgcacc
cccatcgccatggagatcgagcacttcatccaaatcatcactggggtggccgtcttcctg
ggcatgtccttcttcatcctgtccctcatcctgggctacacctggctggaggcggtcatc
ttcctgattggcatcatagtggccaatgtgcccgagggcctcttggccaccgtcacggtc
tgcctgacgctgaccgccaagcgcatggcgcggaagaactgcttggtgaagaacctggag
gccgtggagacgctgggctccacctccaccatctgctcagacaagaccggcaccctcacc
cagaaccgcatgacggtggcccacatgtggttcgacaaccagattcacgaggcagacacc
accgaggaccaaagtggggcaacttttgacaagcgctcactcacctggacagctctggcc
cgcatcgcagggctgtgcaacagggctgtgttcaaggcaggacaggacaaggtccccatt
tccaagagagacacggccggggatgcctccgagtccgccctcctcaagtgcatcgagctc
tcttgcggctccgtccggaagatgcgggacaggaaccccaaagtgaccgagatccccttc
aactccaccaacaaataccagctctccatccatgagccggaagacaagcccagcgggaac
gtgctggtgatgaagggggcccccgagcgcatcctggaccgctgctccaccatcctcctc
caaggacaggaggtgcccctggatgaggagctgcgtgacgccttccagaacgcctacctg
gagctgggcgggctgggcgagagggtgctgggcttctgccagttctacatgccggaagac
cagtttccccgcggcttcaagttcgatgcggatgaggtcaacttcccactcaccaacctc
tgctttgtggggctcatgtccatgattgacccccctcgagcggctgtgccagatgcagtg
gggaaatgccgaagcgctgggatcaaggtgatcatggtgacaggcgaccaccccatcaca
gccaaggccatcgccaagggggtgggcatcatctccgaaggcaacgagaccgtggaagac
atcgccatccggctgaacatccccatcaaccaggtcaaccctcgggaggccaaagcctgt
gtggtccacggctccgatctgaaggacatgacccccgaacacctggacgagctcctgaag
aaccacacggagattgtctttgcccgcacgtccccccagcagaagctgatcatcgtggag
gggtgccagaggcagggggccatagtggccgtgacgggggatggggtgaacgactccccc
gccctcaagaaagcagacatcgggattgccatgggcatctccggctcagatgtctccaag
caggcagcggacatgatcctcctggacgacaactttgcctccatcgtgacgggggtggag
gaaggccggctgatctttgacaacctgaagaaatccattgcctacacgctcaccagcaac
attcccgagatcacccccttcctcttgttcatcattgccaacatgccgctgcccttgggc
accgtcaccatcctgtgcattgacctgggcaccgacatggtgcctgccatctccctcgcc
tacgaggcagccgaaagcgacatcatgaaacggcagccgaggaacccgaagacagacaag
ctagtgaaccagcgtctgatcagcatggcctacgggcagataggcatgatccaggccctg
gggggcttcttcacctattttgtcatcctggctgagaacgggttcctgcccaccaccttg
ctgggcatccgcctggactgggatgaccgttccaaaaatgacctcgaggacagctacggc
caggagtggacgtacgagcagcgcaaggtggtggaattcacctgccacacagcctttttc
gccagcatcgtggtggtacagtgggccgacctgatcatctgcaagacgcgccggaattcc
gtcttccagcagggcatgaagaacaagattctgatcttcggactcctggaggaaaccgct
ctggctgccttcctgtcgtactgccctgggatgggggtggccctccggatgtaccccctc
aaggtcacctggtggttctgcgccttcccctacagcctcctcatcttcatctatgacgag
gtccggaagctgctcctgcggcgctacccagggggttgggtggagaaggagacctattat
taa

DBGET integrated database retrieval system