KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107298231Help
Entry
107298231         CDS       T05763                                 

Gene name
MGAT2
Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00510  N-Glycan biosynthesis
pmur01100  Metabolic pathways
Module
pmur_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107298231 (MGAT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pmur01003]
    107298231 (MGAT2)
Enzymes [BR:pmur01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     107298231 (MGAT2)
Glycosyltransferases [BR:pmur01003]
 Glycan extension
  N-Glycan
   107298231 (MGAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 107298231
NCBI-ProteinID: XP_015683092
Position
Unknown
AA seq 452 aa AA seqDB search
MRLRIYKRKVVALLLVLGAAACALVLWGATSEAGGGSGSKREETASPPPLLGDRPLPPAV
TTNSLPVNGRHSNSSWISREEAPGLNRTLHYRSLVYRLNFDQPIRNEARWRPGGAGPGEV
AVALVVQVHERIEHLRILLDSLRRAPGVEKVLLVLSHDVWSAELNALASSVDFCAVLQIF
FPFSLQLYPGEFPGTDPRDCPRDVGQAAALRMSCLNAHYPDAFGHYRESSFTQTKHHWWW
KLHFVWERVRALREHPGLVVFLEEDHYLAPDFFHVLQRLWALRQRDCPECQLLSLGTYAT
VRGSFAGRADKVELKTWKSTEHNMGMVFARDTYQQLIGCTDAFCTYDDYNWDWTLQHLTV
GCLPHFWKVLVPEIPRIFHTGDCGMHHKKSCQPSVQSAKIDSLLSSNQQYLFPETITISK
RYSMTHLSPHVKNGGWGDIRDHELCKSYRRLQ
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgagactccgcatctacaagcgcaaagtggtggcgctgctgctggtcttgggcgccgcc
gcctgtgccttagtgctttggggagcaacaagcgaggccggcggcggcagcggcagcaaa
cgggaagaaaccgcgtctccgccgccgctcctgggagatcgaccgttgccaccggcggtt
accaccaacagccttccagttaacgggcgtcactcaaattcgtcttggatatcgcgggaa
gaagcgccggggctgaatcgcaccctgcactaccggtctctggtgtaccgactcaacttc
gaccagccgattcgcaacgaggcgcgttggcggcccggcggcgccggtcccggagaggtg
gccgtggcgctggtggtgcaggtgcatgagcgcatcgagcacctccggatcctgttggac
tcgctacgacgcgcgccaggcgtggaaaaagtgctcctcgtgcttagccatgacgtgtgg
tccgccgagttgaatgcgctggcttcttccgtggacttctgcgcggtcctgcagattttc
tttccgttcagcttgcagctctatccgggcgaattcccaggcacggacccacgcgattgt
ccacgcgacgtgggccaagcggcagcgctgcgaatgagctgcctcaacgctcactacccc
gatgcctttggccattaccgtgagtctagtttcacccaaaccaaacaccactggtggtgg
aagcttcactttgtgtgggagagggtgcgtgctctgcgggaacacccgggcttggtggtc
ttcttggaggaggaccactacctggcccctgatttcttccatgttctgcaacgcctctgg
gccctgagacagcgtgactgccctgagtgccagttgctgtccttgggcacttatgccact
gtgcgcggcagctttgctggccgggctgacaaggtggaattgaagacatggaagtccaca
gagcacaacatgggcatggtgtttgctagggacacgtaccagcaactgattggctgcact
gatgccttctgcacctatgatgattacaactgggactggactcttcagcatttgactgta
ggatgccttcctcatttctggaaggtgctggttccagagatccctcgaatcttccacact
ggtgactgtggcatgcaccacaaaaaatcttgccagccgtctgttcagagtgccaaaatt
gactcgctcttaagtagcaatcaacaatacttatttcctgaaaccataactattagcaag
cggtactcaatgacccatttgagcccccatgtgaaaaacgggggttggggtgatattcgg
gaccacgaactctgtaaaagttaccgaagattacagtga

DBGET integrated database retrieval system