KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107298580Help
Entry
107298580         CDS       T05763                                 

Gene name
HTT
Definition
(RefSeq) huntingtin
  KO
K04533  huntingtin
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pmur03019]
    107298580 (HTT)
   04131 Membrane trafficking [BR:pmur04131]
    107298580 (HTT)
   03029 Mitochondrial biogenesis [BR:pmur03029]
    107298580 (HTT)
Messenger RNA biogenesis [BR:pmur03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107298580 (HTT)
Membrane trafficking [BR:pmur04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107298580 (HTT)
Mitochondrial biogenesis [BR:pmur03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    107298580 (HTT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 107298580
NCBI-ProteinID: XP_029142402
Position
Unknown
AA seq 2072 aa AA seqDB search
GPSRFSSLLSRRLVPKLFYGCDGGQADPVVALAKEQSSVYLKLLMHETPPASQFAVSTIT
RTYRGYNLMQGPADVMVENNLSRVISAVSHALTTSPSRSLTFGCCEALCVLSSSFPVCTW
NVGWHCGFSLLGGVEEPQEKSTVGMVGLLLSLLSSVSFPMDLSAHQDALLLAGNLLAASA
SKSLQNPWTHSEDEASVAPAKQEDSWAALADQTLALMVDHLFSHLLKVINICSHILDDAV
PGPTLKATLPSLTNPPSLSPIRRKGKEKDVAEQATVAISPKKTSENSPAPRQSDISSSAP
PSKSSSTLGNFYHLPSYLKLYDVLKATYANYKVTLDLQNVNEKFGAFLRSALDVLSQILE
LATLQDIGKYVEEILCYLKSCFNKEPVMATVCVQQLLKTLFGTNLASQFDSWSSNSCRAQ
GKCQHLGSSNLRPGLYHCCFMAPYTQFTQALADASLRNMMQAEQERDTSGWFDILQKVST
QLKTGTTNMAKHRADKNIIHNHIRLFEPLVIKALKQYTTTTSVQLQRQVLDLLAQLVQLR
VNYCLLDSDQVLEMFILVLQQCHRENEEKWKRLSRQVADIILPMLAKQQMQIDSHEALGI
LNTLFEILAPSALRPVDMLLRSMFVTPSTMASVSTVQLWVSGILAILRVLISQSTEDIVL
SRIQELSFSPRLISCQAIHRLRNGGNNVPGAQETPPEEHERFLPEETFSRFLMQLVGILL
EDITSKQLHVEMSEQQHTFYCQELGTLLICLIHTFKSGMFRRITAAATKLFTGNGPHGLR
FYTLERLNDLVKSMIATHPSLVLLWCQILLLVNYTDSCWWSKVHQTPKRQTLSSAKLLSP
QACGGPRAEDGGAKLSICNREIVRRGSLILFCDYVCQNLHDSEHLTWLTVNHVQELISLS
HEPPVQDFISAIHRNSAASGLFIQAIQSRCENFASPTAVKKTLQCLEGIHLSQSGAVLVL
YVDKLLSTPFRVLAHMVDTLACRRVEMLLAASVQNSTAQLPVEELDRIQEYLQNTGLAHR
HQRLYSLLDRFRLTVAPETISPSPLVTAHPLDGGNHPALETLIPDKDWYCSLVRSQCYTK
SAFGLPEGAELMNRLPEQELVPFMMHQDFNIGLLAPCLSLAGQEVSRGLRSHFEAARLVT
LHQVTEVVRKLPANHQVFQPMRPMGSSPYWNKLGNIYGDPETFQFTMVLAQALSQYLVLL
SKLPASLRIPREKESDIVKFVVMLLEILSWHLICKQVPLSIDLQAVLDCCCLALQQTELW
SLWASAEYTSHSSSLIHCTRFILEAVAIEPGNRLLSPDKGKTIQKAASENDGRGSQTPNS
EYITATCEVVAELVECLQSVLALGHKENRPIPAFLTPVLKNIIVSLSRLPLVNSYARIPL
LVWRLGWSPKPTGEFSTTFPEIPVEFLQEREIFKEFIYRINTLGWTNRMQFEETWATLLG
VLVTQPIVMDPEDNQQEEDMERTQINVLAVQAITSLVLSAMTIPLAGNPAVSCLEQQPRN
KTLKALDTRFGRKLNIIRGTIEQEIQELASKRDNVACHHLYQVWDPVPSLAPSTTGALIS
HEKLLLQINTEREMGNMGYKLGQVSIHSVWLGNSITPLREEEWGDDEDDESDLPALSSPP
SSPINSRKHRAGVDIHSCSQFLLELYSQWILPSSPSKRTPVTLISEVVRSVSFPPFRSRK
SRLGTDKAVAEPVSRLLESTLRSAHMPSRIGALHGILYILECDLLDDTAKQLVPVITEYL
LSNLRGVAHCVNLHNQQHILVMCAVAFYLIENYPADVGPEFSSGIIQMCGVMLSENEGST
PSLIFHCVLRGLERLLLSEQLSQLDCEALVKLSVDRVNVLSPHRAMAALGLMLSCMYTGK
EKVSPGRSADHHPAAPDSESVIVAMERVSVLFDRVRKGFPFEARVVTRILPQFLDDFFPP
QDVMNKVIGEFLSNQQPYPQFMAKVLYKVFQTLHTTGQSSMVRDWVMLSLSNFTQRTPIA
MAMWSLSCFFVSASTSQWISGILPHIISRMGKSEQIDVNLFCLVAIDFYRHQIDEELDRR
AFQSIFEVVSSPGNPYHRLLTCLQSVHKITPC
NT seq 6221 nt NT seq  +upstreamnt  +downstreamnt
aagggccttctcgcttttcttccctcctttctcgcaggctggttccaaaactcttctacg
gttgcgatggagggcaggctgacccagtcgtagccctggcgaaggagcagagcagcgtct
acctgaaactcttgatgcacgaaacgccaccagcttcccagtttgccgtgagcaccatca
ccagaacatacagaggatacaacctgatgcaaggcccagcagatgtcatggtggagaaca
atctttccagagtgatctcggcggtgtcccacgccttgacaacatccccttcgcggtctc
tgacatttggctgctgcgaagcgttgtgtgttttgtcctcgtcgttcccggtttgcacct
ggaacgtgggatggcattgtggtttttctctcctgggaggcgtggaggagcctcaggaga
agagcacagttgggatggtgggcttgctgctgtctctgctttcctccgtttcgttcccta
tggatctctctgctcaccaagatgctttgctcctggctgggaacttgctggcagccagcg
cctccaaatctctgcaaaacccctggacgcacagtgaggacgaagcgagcgttgcgcccg
ctaagcaggaggactcgtgggcggccctggctgaccagacgctggccctgatggtggacc
acctcttttcccatttgctgaaggtcatcaacatttgctcccacatcctggacgatgccg
ttcccggcccgacactaaaggccacgttaccgtctctaaccaacccaccttcgctgagtc
caatccgtcgcaaagggaaagagaaagatgttgcagaacaagccacggtagccataagcc
ctaaaaagacgagtgaaaacagcccagctcccaggcagagtgacatttccagctcagctc
ctccaagtaaatcgtcctccacgttgggtaatttctatcatctcccgtcgtatctcaagc
tctacgacgttctgaaggccacctacgccaactacaaggtcacactcgatctccaaaacg
tcaatgaaaagtttggtgccttcctgagatcagcgttggacgttctctctcagatcttag
aactggcaactctacaagacattggaaagtatgtggaagaaattctgtgttacctgaaat
cctgtttcaacaaagagccggtcatggcgacggtgtgcgttcagcagttactgaagacct
tgtttggcaccaacctggcctctcagtttgacagctggtcttccaactcttgccgagctc
aaggcaaatgccagcacttgggctcctccaacttaaggccgggcctttaccactgctgct
tcatggctccctacacccagttcacccaggccctcgccgatgccagtttgcggaatatga
tgcaggccgagcaggaacgggacacctcgggctggtttgacatactgcaaaaggtttcca
cgcaactgaaaactggcaccacaaatatggccaagcaccgggctgacaagaatatcatcc
acaaccacatccgtctctttgaaccgcttgtcatcaaagcgctcaagcagtacaccacca
ccacgtcggtgcaactgcagcgacaagtcttggatcttctcgctcagctcgttcaactgc
gggtcaactactgtctcctggactctgaccaagtgctggagatgtttatcctggtgctgc
aacagtgtcaccgagagaacgaggagaagtggaagaggctgtcgcgacaggtagcagaca
tcatcctgccaatgctggccaaacaacagatgcagatcgattcccacgaagctctgggga
tactgaacactctgtttgagatcctggccccctccgccctgcgccccgtggacatgctct
tgcgaagcatgttcgtcacgcccagcacgatggcgtccgtgagcaccgtccagttatggg
tctccggcattctggccattctgcgggtcttgatttcccagtccacggaagacatcgtcc
tttcccgcatccaggagctctccttttccccccggctcatctcctgccaggcgattcacc
ggctgaggaacgggggaaacaacgttcccggagcgcaggagacccccccggaggagcacg
agcgcttcctgcccgaagagaccttttccagattcctaatgcagctggtgggaatcctcc
tggaagacatcacgagcaaacagttgcacgtggagatgagcgagcagcaacacacgttct
actgccaggaactgggcacccttctcatctgcttaattcataccttcaaatcaggaatgt
tccgaagaatcacagctgcagctaccaagctttttacagggaacggaccccacggtctcc
gtttctacaccctggagagattaaacgacctcgtcaagtccatgatagccacccacccat
cgctggtccttctctggtgtcaaatcttgctgcttgtgaactacaccgactcctgctggt
ggtccaaagttcatcagacgcccaaaaggcagaccctatcgagtgctaaattgctcagcc
ctcaagcctgcgggggtccccgggcagaagacgggggcgccaaacttagcatctgcaacc
gagagatcgtgcggaggggatccctcatcctgttttgtgactatgtgtgccaaaacctgc
acgactccgagcacttaacctggctgaccgtgaatcacgtccaggaactgatcagtctgt
ctcatgaacccccggtccaggattttataagcgccattcacagaaactcggccgccagcg
ggcttttcatccaggctatccagtcacgatgtgagaacttcgcctctccgacagcggtaa
agaagaccctgcagtgcttggagggcatccatctgagccagtcgggggccgtgctggtct
tgtacgtggacaagcttctctccactcctttccgtgtgctggcccacatggtggacaccc
tggcctgccgtcgcgtggaaatgcttttagcagcgtctgtgcagaacagtacggctcagt
tgccagttgaggagctggaccgaatacaggaatatcttcagaacactggactagcccacc
gacatcaaagactctactccctgttggatcggtttcgtctaacggtggctccggaaacca
ttagcccctcacctttggttacggcacatcccctggatggggggaaccatcccgctctag
aaactttaattccagacaaagattggtactgttcgctggtgaggtcccagtgctacacaa
aatcagctttcggtctgccagaaggtgccgaattgatgaatcggcttcctgagcaagaac
tggttccctttatgatgcaccaggatttcaacatcggcctcctggccccgtgtttgagcc
tggcagggcaggaagtctcccgagggctgaggagccatttcgaagccgcccgcctggtca
cgctgcaccaggtgacggaagtggtgcgcaagctgcccgccaaccaccaggtcttccagc
cgatgcggccgatgggatcctccccgtactggaacaaactcggcaatatttatggagacc
cagaaacctttcagttcaccatggttctagcgcaggctttaagtcagtatctggtgttgc
tttccaaacttccagcttctcttcgcattccccgcgagaaggaaagtgacattgtgaagt
ttgtggtaatgctgctagagatcctgtcttggcacttaatatgcaagcaggtccccctaa
gtattgatctccaggcagtgctggattgctgttgcctggcattgcaacagactgagctgt
ggagtctctgggcatctgcagagtacaccagccattcctcctcgttaatccattgcaccc
gattcatcctggaagcagtggcaattgagccgggaaatcgcctgctgagtccagataaag
ggaagacgatccagaaggccgccagcgagaatgatggaaggggttcacaaacaccaaatt
ccgagtatattacagccacttgcgaagtggtggcagagttggtggaatgcctgcagtccg
tcctggctctggggcacaaggagaaccgccccatccctgccttcctgacccccgttctga
agaacatcatcgtcagcctctctcggctgcccttagtcaacagctacgcgcggattcccc
tcctggtctggaggttgggctggtccccaaagccgacgggcgaattcagcacgacctttc
cggaaatccctgtagagtttcttcaagagcgagaaatcttcaaggaattcatctatcgaa
ttaacaccctggggtggacaaaccgcatgcagtttgaggagacctgggccaccctcctgg
gtgtccttgtgacccagccgatcgtcatggacccggaggacaaccagcaagaggaagaca
tggaaaggacccagataaacgtcctggctgttcaggcgatcacttccttggtgctgagcg
caatgaccatcccgctggccggcaatccggccgtcagctgtttggagcagcagcctcgaa
acaagaccttgaaagctctggacaccaggtttgggagaaaactgaacattatccgaggaa
ccatcgagcaagagattcaggagctggcatctaagagagacaacgttgcttgccaccatt
tgtaccaggtgtgggaccctgttccatccctggccccctctactacaggcgccctcatta
gccacgaaaaactgctgctgcaaatcaatacggaacgtgaaatggggaacatggggtaca
aactaggacaggtctccatccattctgtgtggctgggaaatagcatcacgccgttgcggg
aggaagagtggggtgacgatgaagatgacgagagtgacctgcctgccctttcttcgcccc
cctcctcccccataaattccaggaagcaccgcgccggggtggacatccattcgtgttctc
agttcctgctggaattgtacagccagtggattctcccatccagcccgagcaagaggacgc
cggtcaccctgatcagcgaagtggtccgatccgtaagctttccgcctttccgttcccgta
aatcgcgcctcggaactgataaagctgtggccgagccggtcagccgcctgctggaatcca
cgctccgtagcgcgcacatgcccagccgaattggggcgctgcacggcatcctctacattt
tggagtgcgacctcctggacgacacggcgaagcagctcgttccggtcatcaccgagtacc
tgctgtccaatctgcgaggagttgcccactgtgtgaacctccacaaccagcagcatatct
tggtcatgtgcgccgtggccttctacttaatcgaaaactaccccgctgacgtcgggcccg
aattctcttcaggaatcattcagatgtgcggagtgatgctgtctgaaaacgagggatcta
ctccgtcgttgatcttccactgtgtgctcagaggtctggaaaggcttctcctttcggagc
agctgtctcagctggactgtgaagccctggtcaagctgagcgtggaccgcgtgaacgtcc
tcagtccccacagagccatggcggccttggggctcatgctgagctgcatgtacacaggaa
aagagaaagtcagtcccggacgaagcgcagatcaccacccggcagctccggacagcgaat
cggtcatcgtggcgatggagcgagtgtctgtcctctttgaccgggtcaggaaaggcttcc
cctttgaggcccgggtggtcactcggatcctcccccagtttctggatgactttttccccc
cgcaagacgtgatgaataaagtgattggagaatttttatccaaccagcaaccctacccac
aattcatggcgaaagtactctacaaggtcttccagacgttgcacacgaccggtcagtcct
ccatggtccgggactgggtgatgctgtcgctctccaactttacgcagcgcacgccgatcg
ccatggcgatgtggagcctctcctgtttttttgtcagcgcttccaccagccagtggattt
cggggattctcccacacattatcagcagaatggggaaatcggagcaaatagacgtcaatt
tgttctgcctggtggccatagatttttataggcatcagatagacgaagaactggaccgcc
gagccttccagtcgatctttgaagtggtctcctcgccggggaatccgtatcaccgcctgc
tgacctgcttgcaaagcgtacacaagatcaccccgtgttga

DBGET integrated database retrieval system