KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107299191Help
Entry
107299191         CDS       T05763                                 

Gene name
ESRRA
Definition
(RefSeq) steroid hormone receptor ERR1
  KO
K08552  estrogen-related receptor alpha
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pmur03000]
    107299191 (ESRRA)
   03029 Mitochondrial biogenesis [BR:pmur03029]
    107299191 (ESRRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pmur03310]
    107299191 (ESRRA)
Transcription factors [BR:pmur03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen-like
    107299191 (ESRRA)
Mitochondrial biogenesis [BR:pmur03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    107299191 (ESRRA)
Nuclear receptors [BR:pmur03310]
 3. Estrogen like
  3B. Estrogen-related receptor
   107299191 (ESRRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 107299191
NCBI-ProteinID: XP_015684043
Position
Unknown
AA seq 420 aa AA seqDB search
MSSRERRTEFFIKTEPASPDSLVQHSPSGSSDTSTSGAPAELETASTLPVGTGASRRRHD
EDPDEAPGRGKYMLNTMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGSIEYSCPA
TNECEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVEGAPYPSTFV
TPQIATATAKKSAPMNTMVSHLLVAEPEKLYAMPDPALSEGPVKAASTLCDLADREIVVI
IGWAKNIPGFPALSLADQMSVLQSVWLEVLLLGVAWRSLPCEDEIVFAEDFALDEEAART
AGLLELSSVVLQLVRKYRALRLEREEYVLLKALALANSDSVHIEDMAAVQRLRDVLHEAL
LEYEASRRPEEPRRAGRLLLTLPLLRQTATRVLHHFYSLKLEGKIPMHKLFLEMLEAMMD
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcccgggaacgccggacggaattcttcattaaaaccgagccggcttcccccgat
agcctcgtgcaacacagccccagtgggtcctccgacaccagcaccagcggggcccccgcc
gaactcgagaccgccagcaccttgcccgtcgggacgggggcctcccgccgacgccacgat
gaggaccccgacgaagctcccggccggggaaagtatatgctgaacaccatgcccaagcgg
ctgtgtctggtgtgtggggacatcgcctcggggtaccactatggggtggcctcgtgcgaa
gcctgcaaagcgttcttcaagcggacgatccaaggaagcattgagtacagctgcccggcc
accaacgagtgtgaaatcaccaaacgtcgccggaaagcctgccaggcgtgtcgtttcacc
aagtgcctccgcgtgggcatgctgaaggaaggggtacgcctcgatcgggtacgtgggggt
cgacagaaatataagcgccggccagaggtggagggtgccccctaccccagcacttttgtg
accccacagatcgccacagctaccgccaagaagtcagccccgatgaacacgatggtgtcg
catttgttggtagccgaaccggaaaaactctacgccatgccggacccggcgctttccgag
ggtcccgtgaaagctgcaagcactttgtgtgatctggccgaccgggagattgtggtcatc
attggctgggccaaaaatataccaggattcccagccttgtccttggccgatcagatgtct
gttctgcagagcgtctggctggaggttttgctcctcggcgtcgcctggcgctccctgcct
tgcgaggacgagattgtgtttgcggaagatttcgcgctagacgaagaggcggcccggacg
gcgggactgctggagctgagcagcgtggtcctccagctggtgcgcaaataccgggcgctg
cgcctggagcgggaggaatatgtgctgctgaaggcgttggcccttgccaactcagactcc
gttcacatcgaggacatggcggccgtccaacgcctccgggacgtccttcacgaggcgttg
ctggagtacgaagcctcgcggcgcccggaggaaccacgccgggccggccgccttttgcta
accctcccgctgctgcgccaaaccgccacccgggtgcttcaccacttctacagcttgaaa
ctggagggcaaaatccccatgcataagctgttcctggagatgttggaagccatgatggac
tga

DBGET integrated database retrieval system