KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107300643Help
Entry
107300643         CDS       T05763                                 

Definition
(RefSeq) huntingtin-like
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
SSDB OrthologParalogGFIT
Motif
Pfam: HEAT_EZ HEAT
Motif
Other DBs
NCBI-GeneID: 107300643
NCBI-ProteinID: XP_015685439
Position
Unknown
AA seq 481 aa AA seqDB search
ALMDSSLPRLQLELYKEIKKNGASRSLRAALWRFAELAHLVRPQKCRPYFVNLLPCLTRV
SRRPEESVQETLAAAMPKIMAAFGNFANDSDIKVLLKAFIGNLNSNSPTIRRTAAAATVS
ICQHSRRTQYFYTRLLQVLLGLLCPKEEEHPSVLILGVLLTLRYLIPLLQQQVKDTSLKG
SFGVIQKETEISPSLDQLIQREFSCTFDPSCQHFLDEVDSALEAPSPYFPAKVLSGEEEG
LEEDSEARSETSQMGFAGSVKSELSSELAPTSGLATAAGLASDPPACDIITEQPRSQHVL
QSESELPACDPTGAAPRADADDEILSRSSSQISAIQSDVNDGTSSPISDSSQTTTEGPDS
AVTPSDFSEMILEGGENQYSGMQIGQLQDEEEEATSDLHNEDLDPFRNSCLALVPDKEVR
VSVKALAISCVGAAVALHPEAFFSKLFKMPAESVKEEREQYVKDIVNYIDHGDPQIRGTT
A
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gcgctgatggattctagtctccctcggctacaattggaactctacaaagagattaaaaaa
aacggtgcttcccggagtctgcgggctgctctgtggagatttgctgaacttgcacatctt
gtgagacctcagaaatgcaggccgtattttgtgaacctcctgccctgcttaacccgggtc
agcaggcggcccgaagaatccgtgcaggaaaccctggcggcggcgatgcccaaaatcatg
gcagcttttggaaattttgccaacgacagcgacatcaaggttttattaaaagctttcatt
gggaatctcaactccaactctccaaccatccgtcggacggcggccgcagccacggtgagc
atctgtcagcattcacgaaggacgcagtatttttacacccggttgcttcaagtattgcta
gggctgttgtgtcccaaggaagaagagcaccccagcgtcttgatcctcggggtgttgctc
accctgaggtacctgatcccattgctgcagcagcaggtgaaagacaccagcctgaaaggc
agcttcggggtgatacagaaggaaaccgagatctcgccttccttggaccaactcatacag
agagaattttcatgcacctttgacccatcatgccagcatttccttgatgaggtagactca
gccttagaagcccccagcccatattttcctgctaaagtcctttcaggagaagaagaaggt
ctggaagaagactctgaagccagatctgaaaccagccagatgggctttgcagggtctgtg
aaaagcgagctcagcagtgaattggctcccacctcgggcctggcgacagcggccggcttg
gcctccgatcctccggcttgcgacatcatcacggaacagccccgttctcagcacgtcctg
cagtccgagtcggagctccccgcatgcgatccgacaggcgcggccccgagagctgatgcc
gacgacgagatcctgagccggagttccagccagatcagcgccatccagtcggacgtgaac
gacggcacctcgtcgcccatcagcgacagctcccagaccaccaccgaagggccggactcg
gcggtgaccccctccgatttctccgaaatgattctagagggtggcgagaatcagtactcc
ggaatgcagatcggacaactgcaggacgaagaagaagaagcgacaagcgatctacacaat
gaggacctggatcctttccgaaattcttgcctcgctctggtgccggataaagaagtccgg
gtcagcgtgaaagccttggccatcagctgtgtgggggcagcagtggcccttcacccggaa
gctttcttcagcaaactgttcaaaatgcccgctgaaagtgtcaaagaagaaagggagcag
tacgtgaaggacattgtgaattatatcgaccatggcgatccacagatcagaggcaccact
gcg

DBGET integrated database retrieval system