KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107302785
Entry
107302785         CDS       T05763                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pmur01002]
    107302785 (ERAP1)
Enzymes [BR:pmur01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     107302785 (ERAP1)
Peptidases and inhibitors [BR:pmur01002]
 Metallo peptidases
  Family M1
   107302785 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DASH_Spc34 MHB
Other DBs
NCBI-GeneID: 107302785
NCBI-ProteinID: XP_015687424
Position
Unknown
AA seq 926 aa
MLKKSKMFLLLSILSFLCETSYSFTRDESNPFPWDKIRLPKYVVPVHYDLLIHPNLTTLS
FTGLSKIEILITEQTSSIILHSKYLQITKTTIHNTKNSADTAKGMMVLEHPPFEQIALVS
TEPLQVGQSYIISIEYSANLSESFHGFYKSTYRTLEGETRVLASTQFEATAARMAFPCFD
EPALKATFSVKIRRSPKHLALSNMPLVKSVNINEWLIEDQFDISVKMSTYLVAFIISDFK
SVTKTTLRGIKVSVYTVPHKIKQAEYALDAAVKLLDFFEGYFSIAYPLPKQDLAAIPDFQ
SGAMENWGLTTYRESALLYDSEKSSVSSKLGITMVVAHELAHQWFGNLVTMEWWNDLWLN
EGFAKFMEFVSVRKTHPELKVEDYFLNKYFNAMEVDALNSSHPISTPVEDPAQILEMFDD
VSYDKGACILNMLQDYLSPEVFQAGLVKYLLRFSYQNTKNKDLWDSLSDVCPDVDGSNIQ
NGVCIRNKERVLNSHWTKAVLHDVQAVMNTWTLQKGFPLVTVTIKGKNVHLQQEHYSKKA
TFSSSAGSLWHIPLTYITNKCNDVQRFLLTTKTNDIVLPEEVEWIKFNVGMNGYYIVHYG
DHGWDSLIRLLKDNHETISSNDRASLINNAFQLVSAGKLSIEKALDLTLYLKHESEITPV
YQGLNELVPLYKLLEKTNISDTEQQLKAYIVNLFKNMIDKQSWDDEGTVSEQMLRTSLLM
FACVRKYKPCVDKAQEYFMKWKNSDGTLKLPNNIKMAVYAVGIQTDENWDFLFSKYQLPE
FDTEKNQIEVVLCLSQNKEKLQWLMDQALQGDIIKTQELPSILFSVGRNPYGYQLAWKFL
KQNWQKLVKKFDFGSHSLARMITGITNQYSTKEQLAEVKNYFSSMDKKTSELRAVQQAIE
TIEENIQWMDKNLERIKAWLQINSKV
NT seq 2781 nt   +upstreamnt  +downstreamnt
atgttgaagaagagtaaaatgttcttattgctaagtattctaagttttctatgtgagaca
tcatattcatttactagagatgaaagcaatccttttccttgggataaaattagacttcca
aagtatgttgttccagttcattatgatcttctcattcatccgaatctcacaactctgtct
tttactggattgtccaaaatagagattttaataacagagcaaactagttcaatcatcctt
cacagcaaatatcttcagataaccaaaactactatccacaacaccaagaacagtgctgat
acagctaaaggaatgatggttttagaacatccaccatttgagcagatagcacttgtttct
actgaacctctacaagttggacagagctacattattagcattgagtactctgccaattta
tctgaaagttttcatggtttctataaaagcacgtatagaactctggaaggggaaacaagg
gtgcttgcttcaacccagtttgaggcaacagctgcgcgtatggcctttccttgctttgat
gaacctgcactaaaagcaacattttctgttaagatcagaagaagcccaaagcacctagca
ctatctaatatgcctttggtgaaatcagtaaacattaatgaatggcttattgaggaccag
tttgacatcagtgtaaagatgagcacttacttagtagccttcattatttcagactttaaa
tcagttaccaagacgacattacgtggaattaaggtttcagtatatactgtgccacacaaa
atcaaacaagcagaatatgctttggatgcagcagtgaaacttttagacttctttgaggga
tattttagcattgcatatcctttgccaaaacaagatctagcagctattccagattttcag
tctggtgcaatggaaaattggggattgaccacgtacagggaatctgctttgttatatgat
tctgaaaaatcctcagtatcaagtaaacttggaattactatggtagtagcccatgaactt
gctcatcagtggtttggaaatttggttaccatggaatggtggaatgatctttggcttaat
gaaggttttgccaagtttatggaatttgtgtcagtaagaaagacccatccagaactgaaa
gttgaagattactttttaaacaagtattttaatgccatggaggtagatgctttaaattct
tcacatcctatatcgactcctgttgaagatccagctcagattctagaaatgtttgatgat
gtttcctatgataagggagcttgtattctcaatatgctacaggactatctcagcccagaa
gtttttcaagctggtcttgtgaaatatttgttgcgattcagttatcagaacacaaaaaac
aaagacctgtgggacagcttatcagatgtttgtccagatgttgatggaagtaacatacaa
aatggagtttgtatcagaaacaaggagagagtcttaaactcacactggaccaaagctgtg
cttcatgatgtacaggcagtgatgaatacttggacactccagaaaggatttcctctagtg
accgttactattaaaggaaaaaatgtccatctacaacaagaacattattcaaaaaaagct
actttttcttcatcagctgggagtctgtggcacattccattgacatatattaccaataaa
tgtaatgacgttcagagattcttactgacaaccaaaacaaatgatatagtcctcccagaa
gaagtggagtggataaaatttaatgtaggaatgaatggttattatattgtgcattatgga
gatcatggctgggattctctaattcgcctgttaaaagacaatcatgaaacaataagcagc
aatgatcgagcaagcctcattaacaatgcattccagctggtgagtgctggaaagctgtca
attgaaaaagctcttgatttaacattatacttaaaacatgaatctgaaattactcctgta
tatcaaggactgaatgagctagttcctttatacaaactgttggagaagacaaacataagt
gacacagaacaacaattaaaggcatacatagtaaatctatttaaaaatatgattgacaaa
cagtcttgggatgatgaaggtaccgtgtctgagcaaatgcttcgaacctccttacttatg
tttgcatgtgtacgcaaatacaaaccatgtgtagacaaggcacaagagtacttcatgaaa
tggaagaactcagatggaactctgaaattgccgaataacattaagatggcagtatatgct
gttggaatacaaacagatgaaaactgggatttcctttttagcaagtatcagttacctgaa
tttgatactgaaaagaatcagattgaagttgtactgtgtttgagccaaaacaaagaaaag
cttcagtggttaatggatcaagcattgcaaggtgacataataaagacccaggaacttcct
tctatactttttagtgttggaagaaatccttatggatatcaattagcttggaagttttta
aaacaaaactggcagaaacttgtaaaaaaatttgactttggctcacactcacttgcacgt
atgattactggcataacaaatcagtattccacaaaggaacagcttgctgaggttaaaaat
tatttcagctcaatggacaaaaaaacttcagagctccgtgctgttcaacaagcaatagaa
acaattgaagaaaatatccagtggatggataagaaccttgaaagaatcaaggcatggtta
cagattaatagcaaagtgtga

DBGET integrated database retrieval system