KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107302802
Entry
107302802         CDS       T05763                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pmur01002]
    107302802 (ADAMTS13)
Enzymes [BR:pmur01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     107302802 (ADAMTS13)
Peptidases and inhibitors [BR:pmur01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   107302802 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS ADAM_CR_2 TSP_1 Reprolysin TSP1_spondin Reprolysin_3 TSP1_CCN Reprolysin_4 Reprolysin_5 ADAM_spacer1 Reprolysin_2
Other DBs
NCBI-GeneID: 107302802
NCBI-ProteinID: XP_015687440
Position
Unknown
AA seq 1444 aa
MVSPHSHTALKAEMASKCHLRSWLSPIKDLGALDMCRVLSCHTNSADQSTCSRLHVPLLD
GTECGINKPCLKTQMDFMDEQCSATNVKPLYLHRQLPSFYKWVSAASYAKGTLQGFIRVR
GKKVYIRAVKKQHQCYLVDPHLLRPHIVFSSVQNDSASAQTSGKVSSRIRRVVEEKVKHL
ELLVVVGPDVHQFHKEDTERYILTNLNIGAELLRDPSLGIQFRVHLIKMIVLTEPEEGIQ
ITTNITSSVLSVCKWSLKVNPENDLDPRHADLVLYVTKFDLELPDGNKQVRGVTSKGGAC
SRSWSCIITEDTGFGLGITVAHEIAHSFGIDHDGEGNRCVGDRHIMGSEGGHNSLDLTWS
VCSREQLQAFVSTGQASCTDDLPVLKSSLPEAKPGLYFGAEEQCKVAFGSGASACTFSYD
VDMCRVLSCHTNSADQSTCSRLHVPLLDGTECGINKWCAKGRCSSLEDLSPVSMVHGQWS
SWTSFSACSRSCGGGIATRQRQCNNPRPAFGGQPCQGEALQAEMCNLQPCLKTQMDFMDE
QCSATNVKPLYLHRQLPSFYKWVSAASYAKGDALCQYMCQAAGKNFMVSRGDRFIDGTRC
KKSSLVDKDTLALCVMGSCRMFGCDGRMGSGKKMDPCQVCGGDATSCINVNGFFTEGKAR
EYITFLMLSPNITSVHVVNRKPLFTHMAVKIQGQYTVAGKGLISVNVTYPSILEDNWLEY
KVFLTEDNLPSLEEIHMAGPVQEDVEIQVYRKYGKEYGSATSPDIAFSYFRPSEKETHTW
TAHFSHCSVTCGSGTLQVRYSCFDQSTGEKVDDFYCLKRPKPPSRQERCLMERCQPHWKK
SQLGRCSALCGLGVAIWNMTCVQVVDGLESTVDERLCAADQKPPAFETCSVNVCPLGWNM
GLKSDALEDQERIGNQSVYVWSPLAGKCPVSCGGGRRWLSYVCLVFDTKEETEENRCNQT
QKPASRLEVCNPEPCPPRWFYKQGSCSVTCGEGVMRKALYCARETGEEQEEEEDILPDAA
CEGSPRPKELEACHLQPCPPSWRVTEHGPCSSSCGLGVATQSVACVRLSGGREVDVAEGQ
CPEAEKPPSVVPCLLRVCPYEWGFTKWTECSVSCGTGIQKRQDFCINPQTKTRVNPLLCM
LVPKPMMVRTCSVTPCFQVTTVKEDLRPDVPAATQPPGAEILTTPEVPLPLKGPQDQNLD
LPWSKGEDPQKKEAKAKPWGDISDEPSICGRQWLSPSGLINMTGVQARICTVAIGRPLGE
TITVQVLQSSLNCSAGEILLFSTRTMWRMACKKLKLLMVNTQTNTLIVRQRRLLLGSGVV
LRYTSRLAEKKYHQACDRQLFGPRGLILNPGPSLDGERQMACRIFIDVAPHLRIAIHAVY
VEFQTTGNETHSSYISIRDVESLRTTVFHGNRLFYWESIGSRAEIEFNQALANVSFRAEY
WTNK
NT seq 4335 nt   +upstreamnt  +downstreamnt
atggtaagcccacatagccacacagctttgaaagctgaaatggcttccaagtgccatctg
aggtcctggttatcacctattaaagacctaggagccctggacatgtgccgagttctctcc
tgccacaccaattcggccgatcaatccacctgctctcggctccatgtcccgcttctggat
gggaccgaatgtgggatcaacaagccctgcctgaagacccagatggacttcatggatgag
cagtgttcagcaaccaacgtgaagcccctctacctccatcggcagttgccttccttctac
aagtgggtttcagcagccagctatgcaaaaggtaccttgcaaggttttatccgtgtgcgt
ggcaagaaggtttacatcagagcggtgaagaagcaacaccaatgctacttggtggacccc
catctcctcaggccccacatcgtcttcagcagtgtgcagaacgattccgcatcagcacag
acaagtggaaaggtttcgtcccggattcgcagagtggtggaggagaaggtgaaacatctg
gagctcttggtggtggtagggccagatgttcaccagttccacaaagaagacactgagagg
tacatcctcaccaacctcaacattggagcagagcttcttcgcgatccctcgttgggtatt
caattcagagttcatctgatcaaaatgattgtcctgacagagcctgaggaaggcatccag
atcacgaccaacatcaccagctcggtcctgagcgtctgcaaatggagcctaaaggtcaac
ccagagaatgacctggaccctcgtcatgcagatctcgttctttacgtcaccaaatttgat
ctagaactcccggatggaaataagcaagtacgtggtgtcacttcaaagggaggagcctgt
tcaaggtcttggagctgcatcatcaccgaggacacgggcttcggcttgggcatcaccgtt
gctcacgagatcgcccacagctttgggattgaccacgatggggaagggaaccgctgcgtg
ggagaccgacacattatgggctccgaaggggggcacaacagcctggatctgacctggtcg
gtctgcagccgagagcagctccaggcattcgtcagtacaggccaagcaagctgcacagat
gacttgcctgtgttaaagagcagtctgccagaagcaaagcctggcctatattttggggcg
gaggagcagtgcaaagttgccttcggttcgggggcttcggcctgcactttcagctatgat
gtggacatgtgccgagttctctcctgccacaccaattcggccgatcaatccacctgctct
cggctccatgtcccgcttctggatggaaccgaatgtgggatcaacaagtggtgcgccaaa
ggacgctgcagttccctagaagatctgtctccggttagcatggtgcatggacagtggtcc
agctggacctctttctctgcctgttcccggagctgtggagggggcattgcaacgagacag
cgacaatgcaacaaccccagacctgcttttggtggccagccgtgccaaggcgaagccttg
caagccgagatgtgtaacttgcagccctgcctgaagacccagatggacttcatggatgag
cagtgttcagcaaccaacgtgaagcccctctaccttcatcggcagttgccttccttctac
aagtgggtttcagcagccagctatgcaaaaggagatgctctgtgccaatacatgtgccag
gcagctgggaagaacttcatggtgagccgtggggaccgattcattgatggcacaagatgc
aagaaaagcagcctggtggacaaggatacacttgctttgtgtgtgatgggcagctgcagg
atgtttggatgtgacggccggatgggttccggaaagaagatggatccgtgtcaagtatgc
gggggagacgccacatcctgcattaatgtgaacggctttttcaccgagggaaaagcgaga
gagtacatcaccttcctgatgctgtctccgaacatcacctcagtccacgtggttaaccgg
aaacccctcttcacccacatggctgtgaaaattcaagggcaatacaccgtcgctgggaaa
ggactcatttctgtaaacgtcacctacccttcgatcttggaagacaactggttggaatac
aaggtctttcttacagaggacaatctgcctagcctggaggagattcacatggctggacca
gtccaggaagacgtagagatacaggtttataggaaatacgggaaagaatacggaagcgcc
accagccccgatatcgccttcagctactttagaccgagcgaaaaggagacccacacgtgg
acggcccacttcagccactgctccgtgacctgtgggagtggtaccctgcaagtccgctac
tcctgctttgatcagtcaacaggtgagaaggtggatgacttctactgcctcaagaggcca
aagcctccttctagacaggaaagatgccttatggaacgctgccaaccacattggaagaaa
tcacagctgggccgatgttctgccctttgtggcttgggagtggccatctggaacatgacc
tgtgtccaggttgttgatgggctggaatccaccgtggacgagaggctgtgcgcagcggat
cagaagcctccggccttcgagacttgctccgtgaacgtctgcccgctgggatggaacatg
gggttgaagtccgatgctctggaagaccaagaacggattggaaatcagtctgtatatgtc
tggagtcctttggctggaaagtgtcccgtctcctgtgggggaggacggaggtggctgagt
tacgtctgcttggtcttcgacacgaaggaggaaaccgaggagaaccgctgtaaccagacc
cagaaaccagcaagccgtctagaagtctgcaacccggagccgtgtcccccaaggtggttt
tacaagcaaggttcgtgtagcgttacctgcggcgaaggcgttatgcgcaaggccttgtac
tgcgcgcgagagaccggggaggaacaggaggaagaggaagacatattgcccgacgcggcc
tgtgagggctccccgcgccccaaagagctggaagcgtgccacctgcagccttgccccccc
agctggagagtgaccgagcatggaccctgctcctcttcgtgtgggcttggagtggccacc
caatccgtggcttgcgtgcggctttccggaggccgagaggtggacgtggccgagggccag
tgcccagaagcggaaaagcccccctctgtcgtgccttgccttctccgcgtctgtccgtac
gaatggggcttcaccaaatggacggagtgctctgtctcgtgtggaaccggcatccagaag
cgacaggatttctgcatcaacccccaaaccaagacacgggtgaatcctctcctgtgcatg
cttgttcctaagcccatgatggtgagaacgtgctccgtcacgccctgcttccaagtgacc
acggtgaaggaagaccttcggcctgatgtccctgcggccacccagcctccaggggcagag
atcctgaccacccccgaggttcctcttcctctcaaaggaccgcaggaccagaacctggat
ctcccatggtccaaaggagaagatcctcagaagaaagaagccaaggctaaaccctgggga
gatatctcagacgaacccagtatctgtggaaggcaatggctgagccccagtggattaatc
aacatgacgggggtacaagccaggatctgcacggtcgccataggccggcctttaggggag
accatcaccgtccaggtgttgcagagttccttgaactgcagcgcaggagaaatattactg
ttttcaacccggaccatgtggcggatggcttgtaagaagctgaaactgttgatggtcaac
acccaaaccaacacactgatagtgaggcaacgtcggctgttgttgggcagtggcgttgtg
ctgcgctacaccagcagactggcggagaagaaataccaccaagcctgtgataggcagctg
tttggtccccgggggctcatcctgaatccaggaccgtcactggatggggaacgacaaatg
gcctgcaggatatttatcgatgtggcgccccacctgcgcattgccatccatgcggtgtat
gtggaattccaaaccacaggcaacgaaacacactccagctatatctcgattcgagacgtc
gaatccttgaggactaccgtcttccatgggaaccgtcttttctactgggaatccatcggc
agccgagccgaaatcgaattcaaccaagccctggccaatgtcagcttccgagcggagtac
tggaccaacaaataa

DBGET integrated database retrieval system