KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107303052Help
Entry
107303052         CDS       T05763                                 

Gene name
SLC4A1
Definition
(RefSeq) band 3 anion transport protein
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmur02000]
    107303052 (SLC4A1)
   04147 Exosome [BR:pmur04147]
    107303052 (SLC4A1)
   04090 CD molecules [BR:pmur04090]
    107303052 (SLC4A1)
Transporters [BR:pmur02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   107303052 (SLC4A1)
Exosome [BR:pmur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107303052 (SLC4A1)
CD molecules [BR:pmur04090]
 Proteins
  107303052 (SLC4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2
Motif
Other DBs
NCBI-GeneID: 107303052
NCBI-ProteinID: XP_029143180
Position
Unknown
AA seq 899 aa AA seqDB search
MSLASGDSSSSSPEEEPRGTEPVKPLISHKASHNSYVELHELVMDKNNEFRWMEASHWIK
LEEDFEEMGHWGRPHLSYLTFQSLLEVRKAFNKGTVLLDLQERSLAGIANQVLSQMTNEG
KLKPDDQEVLLRTLLLQHSHPNESTSLNTLLPARVQQTDAKDSTQPLLQEHHQIEMKTFF
NGSEQGESSHSDFKKQLLDKIPSDAEATLGLVGCATFLDRPTLAFVRLKEAVELDSVLEV
PVPVRFLFVVLGPDSPHISYHEIGRAISTMMSERVFRNDSYLAEGRQDLIKSLDEFLDCC
IVLPPSEIQNERLLKMLLPVQKDFLRKRYLPVEKKLEESLKDLGHKLKDHEVKAEDSDDS
LRRTGRIFGGVVKDIKRRYPKYLSDIKDALNPQCLAAVIFIYFAALSPAITFGGLLAEKT
ERLIGVSELLLSTAVQSGLFCLLGAQPLLVVGFSGPLLVFEEAFYTFCTKNNIEYIVGRV
WIGFWLILIVIVVVAFEGSFLVRYISRYTQEIFSILISLIFILETFFKLIKIFKEHPLKE
VYTNITFSRDEEPRGPAPNTALLSLVLMGGTFFIAFFLRKFKNSSFFPGRLRRVIGDFGV
PIAIFIMTLADNLIKDTYTQKLKVPKGLQVSNPEKRGWFIYPTGIAFPIWMMFAAALPAL
LVFILIFLETQITTLIVSKPERKMLKGSGFHLDLLLIVGMGGIAPLLGMPWLSATTVRTV
THANALTVMSKTTLPGEKACIQEVKEQRVTGFLVAILVGLSILMEPILKLIPLAVLFGIF
LYMGVTSLNGIQLYDRILLMLKPPKYHPDISYVTKVKTWRMHIFTLTQILCLGLLWGVKS
SPASLALPFILILTVPLRRFLLPVIFRDIELKCLDSDDAEVTFDETEGQDVYDEVQMPI
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttgcaagtggagacagtagctcctcctcacctgaggaggagccaagaggtacg
gagcctgtgaagccactcatctcccacaaagcttcccataattcatatgtggaactccat
gagctggtcatggacaagaacaatgagtttcgctggatggaagcttctcactggatcaaa
ctggaagaggactttgaggagatggggcattgggggagacctcatctttcatacctgact
tttcaaagccttctggaggtgcgcaaggcatttaacaaaggaactgtccttctagatttg
caagaacgaagtctagctgggattgccaatcaggtgctttcccaaatgaccaatgaagga
aaactcaagcctgatgaccaagaggtgcttttaagaactcttctacttcagcacagtcac
cctaatgaatcaacttcattaaacactctcttgcctgcgcgggtacaacaaacagatgcc
aaagactcaacccaaccactgcttcaagaacatcaccaaatagagatgaagacctttttt
aatggctcagagcagggagagtcaagtcatagtgattttaagaagcagctgttagataag
attccttctgatgcagaagccactctgggattggttggctgtgccaccttcctggaccga
cctactctggcctttgtacgcttgaaggaagcggtggagctggactctgtcctggaggtt
cctgtccctgtcaggttcctttttgtggttctgggccctgattccccccacattagctac
cacgaaatcgggagagccatctcaactatgatgtccgagagggtatttcgcaatgactcc
tatttggcagaaggaagacaggacttgataaagagtctggatgagttcctagattgttgc
attgtcctcccaccctctgagatccaaaatgaaagacttctcaaaatgttgctgccagtg
cagaaggatttcctaaggaagaggtacctcccagtggagaagaaactggaagagtcacta
aaagacctagggcacaaattgaaagaccacgaagtcaaagcagaagattctgatgattcc
ttgcgccgaactggaaggatttttgggggggtagtgaaagacataaaacgtcggtacccc
aagtatctcagtgacatcaaggatgctctgaacccacaatgcctggctgcagtcatcttc
atctattttgctgccctttctcctgccattacttttggaggcctgcttgctgaaaagaca
gagcgcctgataggagtctctgagcttctactctctaccgcagttcagagtggactcttt
tgcttgctgggagctcagcctctgcttgttgtgggattctctggcccccttttggtcttt
gaagaagctttttatacattttgtacgaaaaataacattgaatacattgtggggagagtc
tggattggcttttggctgatactgatagtgatagtggtagtggcttttgagggcagcttc
ctggtgcgttacatctctcgctatactcaggagatcttctcaattctcatctccctcatc
ttcatcctggaaaccttcttcaaactcatcaagatttttaaagagcaccctctgaaagaa
gtgtatacaaacatcaccttttccagagatgaagaaccaaggggtcctgcaccaaatact
gctctgctttctctggtgctgatgggaggaacatttttcattgctttcttcttgcgcaag
ttcaagaatagcagctttttccctggcaggcttcgtcgggtaattggtgactttggtgtc
cctattgccatctttatcatgacattggcagacaatcttattaaagatacctacactcag
aaattgaaggttcccaaaggccttcaagtctccaatcctgaaaagcggggttggtttatc
tatccaactggaattgcattccccatctggatgatgtttgctgcagctttgccagctctc
ctggttttcattctcatcttcttggagacacagatcaccacgctgattgtaagcaaacct
gagaggaagatgctgaagggttcaggtttccatctcgatctccttcttattgttggaatg
ggaggtattgcaccacttctgggcatgccctggctgagtgccaccaccgtgaggactgtc
acacatgctaatgctctgacagttatgtccaagactactctgccaggagaaaaggcctgc
attcaggaggtcaaggaacagagggttactggtttcctggtggctattcttgtgggcctg
tccatactcatggaacctatcttgaagctgattccacttgcagtactctttggcatcttt
ctttacatgggggtgacatctctcaatggaattcagctatatgaccgcatacttctcatg
ctgaagccaccgaaataccatccagatatatcttatgttacaaaagtaaagacctggcgt
atgcacatcttcaccctcacccagattctctgcctaggattgctgtggggagtgaaatcc
agcccagcctcccttgccttgccttttatactcattctgactgtccctcttcgacgcttc
ctgctccctgtcattttcagagacattgagctcaagtgtttggattctgatgatgctgag
gtgacttttgatgagacagaaggccaagatgtctatgatgaagtccagatgcctatttga

DBGET integrated database retrieval system