KEGG   Protobothrops mucrosquamatus (Taiwan habu): 114922383
Entry
114922383         CDS       T05763                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pmur01009]
    114922383 (AKAP5)
Protein phosphatases and associated proteins [BR:pmur01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     114922383 (AKAP5)
SSDB
Motif
Pfam: WSK PadR
Other DBs
NCBI-GeneID: 114922383
NCBI-ProteinID: XP_029139442
Position
Unknown
AA seq 495 aa
MEAKNMEHLAKGIQMDTEQQLETPNTTDPIIVPESPDKKASVFCFKKRKKSCEKVEEKDE
NHESNSLSLRPANQPSDMGHNETEVSNQFWTSGGAWLAFKRLVTLRRRSKSTLKKQTEAC
SRVHLDVDIGDSGRTRFSKEHASSGSKIPCLRLSRSKKRTSHSEIIEQPDCKKKGNDTAS
ILNNKSNKEPEVVAMEVPLDIKQSPSKSLQEGESDNGAMTNMENVSLSNRENKFPDPNCY
IDCGVQSEIIHSETALVTEEEKQIFQLHHGTLYGNLEELENQKFSFNVEISPPIPQDLPE
SEQQLIEREGTKETKSQPFGADIDVVAKNEDVVAKEGHSIEVMLHCSPSVMEDEASDIPV
CFDEEEKSEEKQFTIPGAGIIIMITEAEDDQDDEEESAPTCETFAFPQAIKQKGKKKTSK
NQASTEGCNYTKEDQACSQVPSSFGTNSQEHWTSEQYEMLLIETAASLVKTAIQSSVEQL
VNEMALEQNKQNSLL
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggaagccaaaaatatggaacatttagcaaaaggaattcagatggacactgagcaacaa
ttggaaactccaaatacaactgacccaattattgtccccgagagtccagacaaaaaggct
tctgtcttttgctttaagaaaaggaaaaagtcttgtgagaaggtagaagagaaggatgag
aaccatgaatccaattcacttagcttaaggcctgctaaccagccttctgacatggggcac
aatgaaacagaggtatcaaatcaattttggacttcaggaggggcctggctggctttcaaa
cgactagtgacattaaggagaagatccaaatccactttgaagaaacaaacagaggcttgt
tctcgtgtacatctagatgtggacataggagattctggcaggacacgattttctaaggag
cacgccagttctggttctaaaattccctgcctaagactctcccgaagcaaaaaaaggacc
agccactctgaaataatagaacagcctgattgcaagaaaaaaggaaatgatacagcaagc
atcctgaataacaaaagtaacaaagagccagaggttgtggctatggaagttccactagat
ataaaacaatcccccagcaaaagtctacaggaaggagaaagtgacaatggagccatgaca
aatatggaaaatgtgtcactctccaacagagagaacaaatttcctgatcccaattgttat
attgactgtggagttcaatcagaaataatccattctgaaactgcacttgtaacggaagaa
gagaagcaaatatttcagttacatcatggaaccctctatggaaaccttgaagagttggaa
aatcagaagttcagttttaatgttgagatcagtcctcccattcctcaggatttgcctgaa
agtgaacaacaacttatagaaagagagggaaccaaagagaccaagtcacagccatttggg
gcagacattgatgttgtggccaagaatgaggatgttgttgctaaggaaggtcattccatt
gaagtgatgttgcattgcagcccatctgtaatggaagatgaggcttcagacataccagtt
tgttttgatgaggaagagaaaagtgaagaaaagcaatttaccatacctggggctggcatt
ataatcatgatcactgaagctgaagatgatcaggatgatgaagaagaatcagctcctacc
tgtgaaacgtttgcatttcctcaagccatcaagcaaaaagggaagaaaaaaactagcaaa
aaccaagcttctactgaaggatgcaactacacaaaggaagaccaagcatgctcccaggtc
ccctcttcctttggcaccaacagccaggaacactggacttcagagcaatatgaaatgctg
ttgattgaaacagctgcctcgcttgtgaagacagccattcagtcatctgttgagcagctt
gtcaatgaaatggctttggagcaaaataaacaaaacagtcttttatga

DBGET integrated database retrieval system