KEGG   Protobothrops mucrosquamatus (Taiwan habu): 114923574
Entry
114923574         CDS       T05763                                 

Definition
(RefSeq) uncharacterized protein LOC114923574
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pmur03036]
    114923574
Chromosome and associated proteins [BR:pmur03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    114923574
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank_3 Ank
Other DBs
NCBI-GeneID: 114923574
NCBI-ProteinID: XP_029142494
Position
Unknown
AA seq 1059 aa
MAETKEKMAEIEQASQALLAELSTMEMEYAIEKSCREQAEAFAIQVSRENKKLQRISLAL
LPGLALHQEDPAGLSGGGEGAAPDSALDPMGRCLQQVKDLQLKVSGLLEEKKELTTQVKE
LQALVGRLQHQLEEECAEKQSLKVLKEHNQKMLKRVKRASRLVTEEYGRMSLQLDMEEKL
RQQAEIFARQMLLKQKEAHRQSLVLMQNVGAEAQLLLALEDVAQMTRQLEETKMEHEAQV
KDLESQLAGRPLPVELARLQATLATAEEGKAHLEERLLRAEEKCASLERKGQRFAGLAWS
PRNLLPLLLSASPCSPLMALRERKGAQQAKRGDLRSDEAAAKALEEMMARIKGGVALRPV
RRGGESPSQPPSAAVNKRRSAAVELQDLLSATSRPRKRSSRRKGSQKKQLVDNQLEKLLQ
RRRRIVDQAPVLTEPSVPAADQGLLPPVPGARGEDHAAPPVGLPRGLQPNQSESPETSKG
LPGEADRLTAGAPVHPRPKIAEGFSTLHTAALHGRLDCMKMLIEKYNLDINMASLRGWRP
IHLVLGPESKGTATECLHYLLSKGADVNVQNFNGVSPLHKAASEGRENCLQALIDAGADV
HSRDNEGQKPIDLCKMWGHRSCAKRLSHAMWKADKKHQLRQMCKLDSIKAECEMKQRQFL
QREQRELNICNMMAFESWLVKKGLPLPTGTLLGLAHVQRHSLTLRKVAGQIASPVPSLGT
LLWGERSDSILSMQRRYRRQKPWNLSTNLDSEPATSISRPQLIRLGVEAEKQPPHDFTSF
LFLFKDPFGEPVIQIDNIGRVSSVPDLPYEVLYRSLYPRSWTPRMEVPGGLRPVQIFNLK
HRRPPGPEHWWTDQMALSLRVTLDPVFLSTLRTHVNAYGSAELLSPRTAAFYLSQEQSDS
WEPLRSSGRARQPDHRQSGVRCCASRRRSVDVSDFPHSRHRLTNSLHDNLGSFPDQSGFH
RPRLKSLKLRGEMPAVFGAEPSWSLSLQPSGEELSQQNAGSPFNSWLDSLGQLSNYVFKE
STPPGVSRQIPLKIWTNSGSGQLVKCCIPSYHEEVTCPA
NT seq 3180 nt   +upstreamnt  +downstreamnt
atggcagaaaccaaagaaaaaatggcagaaattgagcaagcttctcaagccctcttagct
gagttgtccaccatggagatggagtatgccatcgagaagagctgccgagagcaggcggaa
gcctttgccatccaggtgagcagggagaacaagaagctgcagcggatcagcctggcgctg
ctgccggggctggcgctccaccaggaagacccagcgggcttgagcggcggcggagaaggc
gccgctcctgactctgcgctggatccgatgggcaggtgccttcagcaggtcaaagacctt
caactcaaggtgtcagggctgctggaggagaagaaggaattgaccacccaggtgaaggaa
ctccaggctcttgtgggaaggctccagcatcagctagaagaggagtgtgcggagaagcag
tctctgaaggttttgaaggagcacaatcagaagatgctgaagagggtcaagcgagcatcc
cgtttggtcaccgaagagtatggcaggatgtcgctgcagttggacatggaggagaaactg
aggcagcaagcagaaatctttgcccgtcagatgctgctgaagcagaaggaggcccaccgt
cagagcctggtcctgatgcagaatgtgggagcggaggcccagcttctcctggccttggag
gatgtggcccagatgacccggcagctggaggagaccaagatggagcacgaggcccaagtg
aaggatctggagagccagttggcgggacggccactgccagtggagctggccaggctgcag
gcaacgttggccacagcagaggaaggaaaggcgcacctggaggagcgccttctccgggcc
gaggagaaatgcgccagcctggagcgaaaaggtcagaggtttgctggtctggcgtggagt
ccaaggaatcttcttcccctcctcctctctgcaagcccctgcagccccctgatggccctc
cgggagaggaaaggcgcacagcaggcgaaaaggggagacctccgctcggacgaggccgcg
gccaaagccctggaggagatgatggcccggatcaagggcggagtggcgctgcggccagtg
aggcgggggggcgagtccccctcccagcccccgtctgccgcggtgaacaagcggaggagc
gcggccgtggagctgcaagacctgctgagtgccacgagccggccacggaagcgatccagc
cggcgtaagggcagccagaagaagcaactggtggacaatcagcttgagaagctcctgcag
agacggcggcgtatagttgaccaagcgccggtcctgaccgagccctccgtcccagctgca
gaccaggggctcctgcctcctgtccccggggccaggggagaagaccacgcagctccaccc
gtggggctcccaaggggcctccagcccaaccagtcagagtccccggagactagcaaaggt
ctaccaggagaagctgaccggctgaccgcaggagcccccgtgcaccccaggccgaagatt
gccgagggcttctccacgctgcacacggccgccctgcatggccggctggactgcatgaag
atgctcatcgagaaatacaacctggacatcaacatggccagcctgcgtggctggaggccc
atccacctggtgctgggcccggagagcaagggcacggccaccgagtgcctccactacctg
ctcagcaaaggcgcagacgtcaacgtgcagaatttcaacggggtgtctcccctccacaag
gcagccagcgaggggcgcgagaactgtctccaggctttgattgacgctggggccgacgtc
cacagccgggacaacgagggacagaaacccatcgacctgtgcaaaatgtggggccacaga
agctgcgccaagcgtctctcccacgccatgtggaaggcggacaagaagcaccagctgagg
cagatgtgcaaactggactccatcaaagccgagtgtgagatgaagcaacggcagttcctt
caaagggagcagagggagctgaacatctgcaacatgatggccttcgagagctggctggtg
aagaagggcctgccgttgcccaccggcaccctcttaggcctggcgcacgtccagcgccac
tcgctgaccctccgcaaggtggccggccagatagccagcccggtcccctccctgggcacc
ctgctgtggggcgagcgctccgactccatcctcagcatgcagcggcgctaccggcgtcag
aagccctggaacctcagcaccaacctggactccgagccggcgacttccatctcccggccg
cagctcatccggctgggcgtggaggccgagaagcagccgccccacgacttcacctccttc
ctcttcctcttcaaggaccctttcggcgagccggtgatccagattgacaacatcggccgg
gtgagcagcgtgcccgacctgccctacgaggtcctttaccggagcctctacccgcgcagc
tggaccccccgcatggaggtgcccgggggactccggccggtgcagatctttaacctgaag
caccggcgtcccccggggcccgagcactggtggactgaccaaatggccctcagcctgcgg
gtcaccctggaccccgtctttctgagcaccctccggacccacgtcaacgcctacggcagc
gctgaacttctgagtcccaggacggcagccttctacctcagccaagaacaaagcgacagc
tgggagcctctgaggtcctccggacgggcccggcagcctgaccatcgccagagcggagtc
aggtgttgcgccagccggaggcgcagcgtcgacgtctctgacttcccacattccaggcac
cgcctcaccaattctttgcacgacaatctcggttccttccccgaccagtccggttttcac
cgaccccggcttaagtccctgaagcttcggggcgagatgccggcagtcttcggggctgaa
cccagttggtccttgtctctgcagccttctggagaggaactctcccagcaaaatgcagga
agcccctttaattcctggctggacagcctgggtcagctcagcaactacgtctttaaggaa
tccactccgcccggggtctctcggcagattcctctcaaaatctggacgaattccggcagt
gggcagctggtgaaatgttgcatcccttcctaccacgaagaggtgacgtgccctgcttag

DBGET integrated database retrieval system