KEGG   Paracoccus mutanolyticus: DPM13_06115Help
Entry
DPM13_06115       CDS       T05551                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pmut  Paracoccus mutanolyticus
Pathway
pmut03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pmut00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DPM13_06115
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pmut03011]
    DPM13_06115
Ribosome [BR:pmut03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DPM13_06115
  Bacteria
    DPM13_06115
  Archaea
    DPM13_06115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AWX92889
UniProt: A0A2Z4PBN2
Position
complement(1123080..1123475)
Genome map
AA seq 131 aa AA seqDB search
MGKEQNPRRVAENEAFAKTKMLRTSPQKLNLVAALIRGKKVEKALADLTFSHKRIAVDVK
KCLQSAIANAENNHNLDVDNLIVAEAWVGKNLVMKRGRPRARGRYGKIMKPFSEITIKVR
QVETIEAGERA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaggaacaaaatccgcgccgcgtggcggagaacgaggcgttcgccaagaccaag
atgcttcgcacctcgccgcagaagctgaacctggtcgcggcgctgatccgcggcaagaag
gtggagaaggccctggccgacctgaccttctcgcacaagcgcatcgccgtcgacgtcaag
aagtgcctgcagtcggccatcgcgaacgccgagaacaaccacaacctcgacgtcgacaac
ctgatcgtcgccgaggcctgggtcggcaagaacctggtcatgaagcgtggccgtccgcgc
gcccgtggtcgttacggcaagatcatgaagccgttttcagaaatcaccatcaaggtgcgt
caggtcgagaccatcgaagccggggagcgtgcgtaa

DBGET integrated database retrieval system