KEGG   Paracoccus mutanolyticus: DPM13_10150Help
Entry
DPM13_10150       CDS       T05551                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pmut  Paracoccus mutanolyticus
Pathway
pmut00630  Glyoxylate and dicarboxylate metabolism
pmut00710  Carbon fixation in photosynthetic organisms
pmut01100  Metabolic pathways
pmut01110  Biosynthesis of secondary metabolites
pmut01120  Microbial metabolism in diverse environments
pmut01130  Biosynthesis of antibiotics
pmut01200  Carbon metabolism
Module
pmut_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:pmut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DPM13_10150
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    DPM13_10150
Enzymes [BR:pmut01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     DPM13_10150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AWX93331
UniProt: A0A2Z4PCH8
Position
1863137..1863526
Genome map
AA seq 129 aa AA seqDB search
MRITQGCFSFLPDLDDNQIRDQVEYILSKDWAVGIEFTDEPHPRNTYWEMWGNPMFDLKD
AKGVMMELDECRKAHGDAYIRINAFDSTRGWETVMMSFIVNRPKSEPSFRTWRMEADGRH
IRYTHEMVG
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcacccagggctgcttttcctttctgcccgacctggacgacaaccagatccgc
gaccaggtggaatacatcctgtcgaaggactgggccgtcggcatcgagttcaccgacgag
ccccacccccgcaacacctattgggagatgtggggcaacccgatgttcgacctgaaggac
gccaagggcgtgatgatggagctggacgagtgccgcaaggcgcatggcgacgcctatatc
cgcatcaacgccttcgacagcacacggggatgggagacggtgatgatgtcctttatcgtc
aaccgtccgaagtccgagccgtccttcaggacctggcggatggaggccgatggccggcat
atccgctatacgcacgagatggtcggctga

DBGET integrated database retrieval system