KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_0325Help
Entry
PMCN06_0325       CDS       T01776                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
pmv00450  Selenocompound metabolism
pmv00970  Aminoacyl-tRNA biosynthesis
pmv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PMCN06_0325 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PMCN06_0325 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pmv01007]
    PMCN06_0325 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pmv03016]
    PMCN06_0325 (metG)
Enzymes [BR:pmv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PMCN06_0325 (metG)
Amino acid related enzymes [BR:pmv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PMCN06_0325 (metG)
Transfer RNA biogenesis [BR:pmv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PMCN06_0325 (metG)
 Prokaryotic type
   Other AARSs
    PMCN06_0325 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 DALR_1 FeoC
Motif
Other DBs
NCBI-ProteinID: AFF23580
Position
332772..334820
Genome map
AA seq 682 aa AA seqDB search
MANSARDILVTCALPYANGAIHLGHLLEHIQADIWVRFQRMRGHKVHFICADDAHGTPIM
LNADKLGITPEALIARSKADHVADFEGFNISYDNYHSTHSPENEALTAEMYKKLRANGFI
KSRTISQLFDPEKGMFLPDRFVKGTCPKCKAEDQYGDNCEVCSSTYSPTELINPRSVVSG
ATPVLKESEHFFFDLPAFEGMLKAWIKSGSLQPEIANKMQEWFESGLQQWDISRDAPYFG
FKIPDTEDKYFYVWLDAPIGYMASFKNLCDKTGLNFDDFWKKDSSAELYHFIGKDIVYFH
SLFWPAMLDGCDLRKPTNVFAHGYVTVNGVKMSKSRGTFIQASTYLRHLAPEYLRYYYAA
KLNNRIEDLDLNLEDFVQRLNADVVNKFVNLASRSAGFITKRFDGKLSAEIAEPELLAEF
VEKAAQIATYYEEREFGKVVREVMQLADKANKYIDDKAPWVMAKEEGREAELQAVCSMAL
QLFRVLAIYLKPVIPQIIARAEAFLQDELTWESLNRPLLNHAILPFKALAQRLDPKQIEA
IVNETKEQFVAQQALEQKNSAKAEPASQVEPIAETISIEDFAKLDLRVAKVMKCEAVPES
NKLLRFELDLGDHTRQVFSGIKEAYNNPAELEGRFVVVIANLAPRKMRFGVSEGMILSAG
TGGADLFLLNADHGVKPGMQVK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggcaaattcggcacgcgatattttggtcacttgcgccttaccttatgcaaatggtgca
attcatttagggcatttattagaacatattcaagcagatatttgggtgcgtttccaacgt
atgcgtgggcataaagtgcattttatttgtgcagatgatgcgcatggcacaccaatcatg
ttaaatgcggataaattaggtattacaccagaagcattaattgctcgctcgaaagcggat
catgtggcggattttgaaggctttaatattagctatgataattatcattccactcacagc
ccagaaaatgaagccttaacagcagaaatgtataaaaaattacgtgctaatggctttatt
aaaagtcgtacgatttcacaattattcgatccagaaaaaggcatgtttttacctgatcgt
tttgttaaaggcacttgcccaaaatgtaaagcagaagatcaatatggtgataactgtgag
gtctgttcatccacttatagcccaacggaattaattaatccgcgttctgtagtttctggt
gctactcccgtattaaaagaatcggagcatttcttctttgatttacctgcgtttgaaggc
atgttaaaagcgtggatcaaatccggttcattacaacctgaaattgccaacaaaatgcaa
gaatggtttgagtcgggtttacaacaatgggatatttcccgtgatgcgccgtatttcggc
tttaaaattccggatacagaagataaatatttctatgtctggttagatgccccaattgga
tatatggcatcgtttaaaaatttgtgtgataaaacaggcttaaattttgacgatttctgg
aaaaaagacagctcggcagagctttatcacttcatcggtaaagatatcgtgtatttccac
agtttattttggccggcgatgttagacggttgcgatttacgcaaaccaactaacgtgttt
gcccatggttatgtgactgtaaatggggtgaaaatgtcaaaatctcgtggcacttttatt
caagcgtccacctacttacgtcatttagcgccagaatatttacgttattactatgcggca
aaattgaataaccgtattgaagatttagacttaaatttggaagactttgtacaacgttta
aatgcggatgtggtgaataaatttgtcaatctggcttcacgcagtgccgggtttatcacg
aagcgttttgatggcaaattatcagctgagattgctgaacctgaattattggcagaattt
gtggaaaaagccgcgcaaattgcgacttattatgaagaacgcgaattcggtaaagtcgtg
cgtgaagtgatgcaattggcggataaagcgaataaatacattgatgacaaagcgccatgg
gtgatggcgaaagaagagggacgtgaggcggaattacaagctgtttgttcaatggcattg
caattattccgcgtcttagccatttatttaaaaccagtgattccacaaattattgcgcgt
gcggaagccttcttacaggatgagttaacgtgggaaagcttaaatcgcccgctgttaaat
cacgcaattttaccgtttaaagcgttagcacagcgtttagacccaaaacagattgaggca
attgtgaacgaaaccaaagaacaatttgtagcccagcaggcattagagcaaaaaaattca
gcaaaagcagaacctgctagccaagtggaaccaatcgcagagacgatcagcattgaggat
ttcgcgaaattagatttacgtgtggcgaaagtgatgaaatgtgaagcggtaccagaatca
aacaaactcttacgttttgagttagacttaggtgatcatacgcgtcaagtgttctctggg
attaaagaagcatataacaatcctgcggaattagaagggcgttttgtcgtggtgattgcc
aaccttgcgccacgtaaaatgcgttttggcgtatcagaagggatgattttaagtgcgggg
acaggtggagctgacttgttcttattgaatgccgatcacggtgttaaacctggtatgcag
gtaaaataa

DBGET integrated database retrieval system