KEGG   Paenibacillus mucilaginosus K02: B2K_09240Help
Entry
B2K_09240         CDS       T02041                                 

Definition
(GenBank) ROK family transcriptional regulator
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
pmw00010  Glycolysis / Gluconeogenesis
pmw00052  Galactose metabolism
pmw00500  Starch and sucrose metabolism
pmw00520  Amino sugar and nucleotide sugar metabolism
pmw00521  Streptomycin biosynthesis
pmw01100  Metabolic pathways
pmw01110  Biosynthesis of secondary metabolites
pmw01120  Microbial metabolism in diverse environments
pmw01130  Biosynthesis of antibiotics
pmw01200  Carbon metabolism
Module
pmw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pmw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B2K_09240
   00052 Galactose metabolism
    B2K_09240
   00500 Starch and sucrose metabolism
    B2K_09240
   00520 Amino sugar and nucleotide sugar metabolism
    B2K_09240
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    B2K_09240
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    B2K_09240
Enzymes [BR:pmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     B2K_09240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Hydant_A_N BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AFH60902
UniProt: I0BEV5
Position
2077391..2078362
Genome map
AA seq 323 aa AA seqDB search
MSRYIGIDIGGTNMVCGLTDGEGQVLRTVKIATEAPSGSKEVIRRLAEAVTGLMTHAGGQ
VSAVGIGLPGFVDHVQGISELAVNLGWKNVPLADELRGHIGDIPVFLDNDVRMYVYGEAV
AGAGRGFSHVLGVTIGTGMNSALVADGKLYYGAGGRAGEIGHVPMEGLTYPCNCGMTGCL
ETAVSANGIARQGREAVARGERSLLGEWFPEDGGARLTAADVSRAYDLGDAAAAAILRRT
GTLLGRGLAAAVTQLAPQVLIIGGGGAQAGERLLGPMKEELKRCVLPFYWEQLTVKTAER
LEDAGVVGSALYAKGRLEAQAQQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaggtatataggtatcgatatcggcggaacgaatatggtatgcgggttgacggac
ggggaggggcaggtgctgcgcacggtcaagattgcgacggaggccccgagcgggagcaaa
gaagtgatccgccggctggccgaggcggtgaccgggctgatgacccatgcaggcggacag
gtgtcagccgtggggatcggtcttcccgggttcgtggaccatgtccaggggatctccgag
ctggcggtgaatctcggctggaagaacgtgcctctggcggacgagctgcgggggcatatc
ggtgacattccggtattcctcgataacgacgtgcggatgtacgtctacggcgaagccgtg
gcgggagcgggccggggcttctcgcacgtgctcggcgtaacgatcggcactggcatgaac
tcggcgctggtggcggacggcaagctgtactacggcgccggcggacgggccggagagatc
gggcacgtgccgatggaagggctgacctacccgtgcaactgcgggatgaccgggtgtctc
gagacggccgtctccgcgaacggcatcgcccgtcagggacgcgaagccgtggcccggggg
gaacggtcgctgctcggcgaatggttcccggaggacgggggagcgcgcctgacagcggcc
gacgtctcgcgggcctatgatctgggcgatgcggcggcggccgccatcctgcggcggacg
ggaacgctgctcggccgcggacttgcggcagccgtgacccagctggccccgcaggtgctg
atcatcggaggaggcggagcgcaggccggagagcggctgctcggccccatgaaggaggag
ctgaagcgctgcgtgctgccgttctactgggagcagcttacggtcaagacagccgaacgg
ctggaggatgccggggtcgtcggaagcgctctgtacgcgaagggcagactggaagcgcag
gcacagcagtag

DBGET integrated database retrieval system