KEGG   Paenibacillus mucilaginosus K02: B2K_15390Help
Entry
B2K_15390         CDS       T02041                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
pmw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmw01100  Metabolic pathways
pmw01110  Biosynthesis of secondary metabolites
pmw01130  Biosynthesis of antibiotics
pmw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B2K_15390
Enzymes [BR:pmw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     B2K_15390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh PEP_mutase IMPDH
Motif
Other DBs
NCBI-ProteinID: AFH62088
UniProt: I0BI91
Position
3511454..3512266
Genome map
AA seq 270 aa AA seqDB search
MFLDRIVTTKHEEVAQLQARTTIAEMEKIIAALPPTLGFERALGAGRQRSMGLIAEVKKA
SPSKGLIREDFEPVSLARAYEQAGADCISVLTDVQYFQGANEYLTRVREAVNVPLLRKDF
TIDPYQIYEARCIGADAILLIAAILTTEQMREYQQTARSIGLDVLIEVHDKEELDRVLEL
SPTMVGINNRNLRTFVTDLHTTEELIQYIPKDVTVVSESGISRSEEITYLESIGARAVLV
GEHFMRQESVGGAVDDLLGVRPEASASREL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgatcgaatcgtaacgacgaaacacgaggaagtcgcccagctccaagcgcgg
acgacgatcgccgagatggagaagatcattgcggcgctgccgccgacgcttggctttgag
cgggccctcggggcaggccgccagcgcagcatggggctcatcgccgaggtgaagaaggcc
tcgccttccaaaggcctcatccgggaagacttcgagcccgtgtcactggcccgagcttat
gaacaggccggagccgactgcatctcggtgctgaccgacgtgcagtattttcagggggcg
aacgagtacctcacgcgtgtaagggaggcggtgaacgttccgctgctgcgcaaggatttc
accatcgacccgtaccagatctatgaagcccgctgtatcggtgcggatgcgatcctgctg
attgcggcgatcctgacgacggagcagatgcgcgaatatcagcagacggcgcgcagcatc
gggcttgacgtgctgatcgaagtgcatgacaaggaagagctggaccgcgtgctggagctg
tccccgacgatggtgggcatcaacaaccggaatctgcgcactttcgtgacagatcttcat
acgaccgaagaactcattcaatatatacctaaagacgtaacggtagtcagcgagagcggc
atctcccgcagcgaagagattacatacctggagtcgatcggcgccagggccgtgcttgtc
ggcgagcacttcatgaggcaggagagcgtaggcggggcggtcgacgacctgctgggagtc
cggccggaagcttcggcttccagggagctgtaa

DBGET integrated database retrieval system