KEGG   Paenibacillus mucilaginosus K02: B2K_15405Help
Entry
B2K_15405         CDS       T02041                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
pmw00260  Glycine, serine and threonine metabolism
pmw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmw01100  Metabolic pathways
pmw01110  Biosynthesis of secondary metabolites
pmw01130  Biosynthesis of antibiotics
pmw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B2K_15405 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B2K_15405 (trpA)
Enzymes [BR:pmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     B2K_15405 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: AFH62091
UniProt: I0BI94
Position
3514144..3514977
Genome map
AA seq 277 aa AA seqDB search
MNRIDAKFAALKEQDLTAFIPFLTIGDPDVRTSIDIIHELEKAGASMVELGVPYSDPLAD
GPVIQRSSMRALKANRITILDVIGAAKTAREEGSELPFILFTYYNPVLQTGLDRIFPLLV
ESSISGLIIPDLPMEEDEEVRRLAEQHGIHLIPLVAPTSRERVERIASRASGFVYCVSSL
GVTGTRTEFHTGIDEFLSTVKGATSLPIAIGFGISTPEQVARFSGVCDGIVVGSALVRTV
EEALPLLSEPASRREGLLQIHDFVRTLVGNGSGIVRT
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggatcgacgccaaattcgctgctctgaaggagcaggatcttaccgcattcatt
ccgttcctcaccattggtgacccggatgtccgcacctcgatcgacatcattcacgagctg
gagaaggccggcgcttccatggtggagctcggcgtgccttattccgatccgctggccgac
gggccggtcatccagcgttcctccatgcgggcgctcaaggcgaaccggatcacgattctc
gatgtgatcggggcggccaagacggcgagggaggaaggcagcgagctgccgttcattttg
tttacctattataatccggtgctgcaaaccggccttgaccggatcttcccgcttctggtg
gagagcagcatcagcggcctcatcatccctgatctgccgatggaagaggatgaggaagtg
cgccggctggcggagcagcacggcatccacctgattccgctggtggcgccgacctcccgg
gagcgcgtggaacggatcgcttccagagcgagcgggttcgtctactgcgtgtcctcgctt
ggcgtgaccggtacccggaccgagttccatacgggcatcgacgagttcctgagcaccgtc
aagggagcgacttcgctgccgatcgccattggcttcggcatctcgacgccggagcaggtg
gcccgcttctcgggggtctgcgacggcattgtcgtaggcagcgcccttgtgcggacagtc
gaagaggcgctgcctctgctgtccgagccggcctcccgcagagaaggactcttgcaaatt
catgattttgtgcgtacattagtgggaaacggttccggcatcgtgcggacctga

DBGET integrated database retrieval system