KEGG   Paenibacillus mucilaginosus K02: B2K_15675Help
Entry
B2K_15675         CDS       T02041                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
pmw  Paenibacillus mucilaginosus K02
Brite
KEGG Orthology (KO) [BR:pmw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pmw03009]
    B2K_15675
Enzymes [BR:pmw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     B2K_15675
Ribosome biogenesis [BR:pmw03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    B2K_15675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AFH62143
UniProt: I0BIE6
Position
complement(3573672..3574376)
Genome map
AA seq 234 aa AA seqDB search
MAGSSPVIPVLYEDNHVIVVVKPPNVPTQEDDSRDPDLLTLIKADLKHRHGKPGNVYLGL
VHRLDRPVGGVMVFAKTSKAASRLSDAVRTRTIRKVYSAVLHGRPKQPQGTLRHHLLKNE
RTNMVSAVPASKAGAKEAVLDYRVLGSQDGLSLVQVELHTGRPHQIRVQFATTGCPLVGD
QRYGGTLAQPGQQIALWSSILEFSHPVTKEALKFTSRPPKSFPWLLWEEASYGL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggccggctcctcccccgtcatccctgtcctgtatgaggacaaccatgtcatcgtggtc
gtgaagccgcccaatgtgccgacgcaggaggatgactcccgcgaccccgatctgctcacg
ctgatcaaggccgacctgaagcaccggcacggcaagcctggcaacgtataccttggcctc
gtccaccggctggaccggcccgtaggcggcgtgatggtgttcgccaagacgtcgaaggcg
gcatcccgcctctccgacgcggtgcgcacgcgcacgatccgcaaggtgtactccgccgta
ctacacggccggccgaagcagccgcagggcaccctccggcatcacctgctgaagaacgag
cggacgaacatggtgtccgccgttccggcctccaaggccggcgcgaaggaggcggtgctc
gactaccgggtgctgggcagccaggacggcctgtcgctcgtgcaggtggagctgcacacc
gggcgcccgcaccagatccgcgtgcagtttgccactaccggctgccccctcgtcggggat
cagcgctacggcggcaccctggcccagccgggccagcagatcgccctgtggtccagcatc
ctagagttctcccatccggtgaccaaggaggcgctgaagttcacctcccggccgccgaag
tcgttcccttggctgctgtgggaggaagcatcgtacgggctgtag

DBGET integrated database retrieval system