KEGG   Paenibacillus mucilaginosus K02: B2K_17915Help
Entry
B2K_17915         CDS       T02041                                 

Definition
(GenBank) ferredoxin
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
pmw00010  Glycolysis / Gluconeogenesis
pmw00020  Citrate cycle (TCA cycle)
pmw00620  Pyruvate metabolism
pmw00640  Propanoate metabolism
pmw00650  Butanoate metabolism
pmw00680  Methane metabolism
pmw01100  Metabolic pathways
pmw01120  Microbial metabolism in diverse environments
pmw01130  Biosynthesis of antibiotics
pmw01200  Carbon metabolism
Module
pmw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B2K_17915
   00020 Citrate cycle (TCA cycle)
    B2K_17915
   00620 Pyruvate metabolism
    B2K_17915
   00640 Propanoate metabolism
    B2K_17915
   00650 Butanoate metabolism
    B2K_17915
  Energy metabolism
   00680 Methane metabolism
    B2K_17915
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    B2K_17915
Enzymes [BR:pmw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     B2K_17915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4 Fer4_7 Fer4_2 Fer4_6 Fer4_21 Fer4_10 Fer4_16 Fer4_8 Fer4_9 Fer4_4 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AFH62575
UniProt: I0BJM8
Position
4044394..4045407
Genome map
AA seq 337 aa AA seqDB search
MRVLPKTNDLGFFEIRLESIGGLGANLAGKMLAEAGVVGSGFNGVSFSSYGSEKKGSPVK
AHIRFCDLNTNIRDTTPVERPHVVGVFHENLSKTVNVISGMYEDSLVLVNSPKSPAELKE
KLKLVGGTIAVVDATGIALEEKNRVNMAMLGGLFRLCEFLDFEHMKGIIRKSLEKKYPGA
VEPALRTFQRGYDEVQFQTFSLPEGLEMPMPKRWDIPVYGYETQAIGGMVSNPGNSILKD
LSISRSGMMPHFDEEKCIHCAACDTACPDFCFVWDEAADKKGRPQMFLQGIDYQYCKGCL
KCVVACPTEALTSNRETDGYGEAHRIPHRFRLAAKSV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcttaccgaaaacgaatgacctcggtttcttcgaaatccgactcgagtccatc
ggcggcctgggtgcaaacctggcaggcaaaatgctggccgaagcgggcgtcgtcgggagc
gggtttaacggtgtcagcttctcttcctacgggtccgagaaaaagggatcgcccgttaag
gcacatatccggttctgtgatctgaacacgaacatccgggacacgacgcccgtggagcgg
ccgcatgtcgtaggcgtgttccacgagaatctgtcgaagaccgtgaacgtgatcagcggc
atgtatgaggacagtctcgtgctcgtcaactcgcccaagagtccggcggagctgaaggag
aagctgaagctggtcggcggcacgatcgccgtggtcgatgcaacgggcatcgcgctcgag
gagaagaaccgggtcaacatggccatgctcggcggtctgtttcggctctgtgagttcctt
gattttgaacacatgaaaggcatcatccgcaagtccctggagaaaaaataccccggcgcc
gtcgagcccgccctgcggacgttccagcgcggatacgatgaagtgcagttccagaccttc
tcgctgcccgaaggcctcgagatgccgatgccgaagcggtgggatatcccggtatacggc
tatgagacgcaggcgatcggcgggatggtgtccaacccaggcaactcgatcctcaaagac
ctgagcatctctcgcagcgggatgatgcctcacttcgatgaagaaaaatgcattcactgc
gccgcctgtgatacggcctgtcccgacttctgcttcgtatgggacgaggccgccgacaag
aaaggccgtccgcagatgttcctgcagggcattgactaccagtactgcaagggctgtctg
aagtgtgtggtggcctgtccgactgaagcgcttacatccaaccgggagacggacggctat
ggggaagcccaccgtattccgcaccggttccggctcgcagcgaagtccgtataa

DBGET integrated database retrieval system