KEGG   Paenibacillus mucilaginosus K02: B2K_17920Help
Entry
B2K_17920         CDS       T02041                                 

Definition
(GenBank) pyruvate synthase
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
pmw00010  Glycolysis / Gluconeogenesis
pmw00020  Citrate cycle (TCA cycle)
pmw00620  Pyruvate metabolism
pmw00640  Propanoate metabolism
pmw00650  Butanoate metabolism
pmw00680  Methane metabolism
pmw01100  Metabolic pathways
pmw01120  Microbial metabolism in diverse environments
pmw01130  Biosynthesis of antibiotics
pmw01200  Carbon metabolism
Module
pmw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B2K_17920
   00020 Citrate cycle (TCA cycle)
    B2K_17920
   00620 Pyruvate metabolism
    B2K_17920
   00640 Propanoate metabolism
    B2K_17920
   00650 Butanoate metabolism
    B2K_17920
  Energy metabolism
   00680 Methane metabolism
    B2K_17920
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    B2K_17920
Enzymes [BR:pmw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     B2K_17920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II TPP_enzyme_C Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AFH62576
UniProt: I0BJM9
Position
4045528..4047831
Genome map
AA seq 767 aa AA seqDB search
MAIEINKEVSTGTVEQRMVYESGNEMAAYAAHQINYHVMGYFPISPSTEVAQFLDLMKAN
GQHDIKLIPADGEHGSAGICYGASTAGGRVFNATSANGYLYMLEQMPVQSGTRFPMVMNL
VCRSVSGPLNIHGDHSDLYYALNTGWPILMCRDPQAVYDMNIMAIKLAEDPEVRLPVIVA
SDGYFTSHQKRRVQTFAHKSDVHAFIGEQPKQFPHVLDRNNPITVGPYMNEPDYINNCYQ
QSQAMYKAGEVFDRIQQEYKVLTGREYPILDLYRMEDAEVAVFLMNSASEIIKDVVDQLR
AQGIKAGSIAPNMIRPFPAKQIAEALKNVKAVTIGDRADSYGAHGGNMTLEIKAALFTEG
NRHTQVVSRVYGLGGKDFYAEDGHAFFELAIEAASNGQVAVPFDYYGHTPGDPSKRPERV
LEPMRYEDLKTGLITVNKDEATGQLKVKVPPLRSLTKKPKRLAPGHGACPGCGIFSGLEL
FFKGIEGDIVALFHTGCAMVVTTGYPYSSHKATYIHNLFQSGAATLSGVVEMFWERKRRG
ELDHLNLPDDFTFVMITGDGGMDIGMGPAIGAALRNHKMIILEYDNEGYMNTGAQLSYST
PLGHRTSTSNVGKHQGGKLFHHKDTPQIMASTNIPYVFTGSEANPQDLLKKAAKAQYYAQ
NEGLVYGKILITCPLNWLSEEQIGQTLIDQAVNSCFFPLYEIENGVTTITYNPEEKSKRI
PVGEWLKNMGKTKHMTKPEYAEALLSFENEVERRWKRLKAKHEHPDL
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgagatcaataaagaggtcagtacaggtacggtcgagcagcggatggtgtat
gagtccggcaacgagatggcggcttacgcggctcaccagatcaactatcatgtgatgggg
tattttccaatctccccgtcgactgaggtcgcccagttcctcgacctgatgaaagcgaac
ggccagcatgacatcaagctgatcccggccgacggcgagcacggctccgcggggatctgc
tacggtgcttccacggccggcggacgcgtgttcaacgcgacctcggcgaacggctacctc
tatatgctcgagcagatgcccgtgcagtccggcacccggttcccgatggtcatgaacctc
gtctgccgctcggtgtccggtccgctcaacatccacggcgaccactccgacctgtactat
gcgctgaatacgggctggccgatcctcatgtgccgcgacccgcaggccgtctatgacatg
aacatcatggcgatcaagctggcggaggatcccgaagtacgccttccggtcatcgtagcg
tcggacgggtacttcacgtcccaccagaagcgccgggtccagaccttcgcgcacaagtcg
gacgtgcatgcgttcatcggcgagcagccgaaacagttcccgcacgtgctcgaccgcaac
aacccgatcaccgtcggcccttacatgaacgagccggattacatcaacaactgctaccag
cagtcccaggcgatgtataaagcgggcgaggtgttcgaccgcatccagcaggagtacaag
gtgctgaccggccgcgagtacccgatccttgacctgtaccggatggaggacgcggaggtg
gccgtgttcctgatgaactccgcttcagagatcatcaaggatgtcgtggaccagctgcgc
gctcaaggcatcaaggcgggctcgatcgccccgaacatgatccgcccgttcccggcgaag
cagatcgccgaggcactgaagaatgtcaaggccgtgacgatcggcgaccgtgcggattcc
tacggcgcccatggcggcaacatgacgctcgagatcaaggcagcgctgttcaccgaaggc
aaccggcatacgcaggtcgtctcccgcgtgtacggccttggcggcaaggacttctacgcg
gaagacggccacgcgttcttcgagctggcgatcgaggcggcaagcaatggccaagtggcg
gtaccgttcgattactacggccacacgccgggcgacccgtcgaagcggccggagcgtgtg
ctcgagccgatgcgctacgaggacctgaagaccgggctcatcacggtgaacaaggacgaa
gctaccggtcagctgaaggtcaaggtaccaccgctgcgcagtctcacgaagaagccgaag
cggctggctccggggcacggcgcctgtccggggtgcgggattttctccggactcgagctt
ttcttcaagggcatcgaaggcgacatcgtagcgctgttccacacgggctgcgcgatggtc
gtcaccaccggctatccgtactcctcgcacaaggcgacgtacatccacaacctgttccag
agcggggcggctacgttgtccggtgtcgtggagatgttctgggagcgcaagcggcgcggc
gagctcgaccacctgaatctgccggatgacttcaccttcgtcatgatcaccggcgacggc
ggcatggacatcgggatggggccggcgatcggcgcggcactgcgcaaccacaagatgatc
atcctcgagtacgataacgagggctacatgaacacaggggcacagctgtcgtactcgacc
ccgctcggccaccggacttcgacgtctaacgtcggcaagcaccagggcggcaagctgttc
caccacaaggatacgccgcagatcatggcgtcgacgaacattccttacgtgttcacgggc
agcgaggcgaacccgcaggacctgctgaagaaagccgccaaggcccagtactatgcgcag
aacgaaggactcgtctacgggaagatcctgatcacgtgcccgctgaactggctctccgag
gagcagatcgggcagaccctgatcgaccaggcggtgaactcgtgcttcttcccgctctat
gagatcgagaacggcgtgacgacgatcacctacaatccggaggagaagagcaagcggatc
ccggtcggcgagtggctgaagaacatgggcaaaaccaagcacatgaccaaacccgaatac
gccgaggcgctgctctccttcgagaacgaagtggaacgccgctggaaacgtctgaaggcc
aagcacgagcatccggacctctaa

DBGET integrated database retrieval system