KEGG   Paenibacillus mucilaginosus K02: B2K_29775Help
Entry
B2K_29775         CDS       T02041                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
pmw00220  Arginine biosynthesis
pmw00330  Arginine and proline metabolism
pmw01100  Metabolic pathways
pmw01110  Biosynthesis of secondary metabolites
pmw01130  Biosynthesis of antibiotics
pmw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    B2K_29775
   00330 Arginine and proline metabolism
    B2K_29775
Enzymes [BR:pmw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     B2K_29775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFH64841
UniProt: I0BR44
Position
complement(7035554..7036480)
Genome map
AA seq 308 aa AA seqDB search
MMETSEAQESLAAGRARVQLIQVPFGLGAGRPGEEQGAESIVKAGLVRMIRALGREVSEE
QISGMWLRETSGRPFTTAKNLPAVLEMLGLAARRVEQAVEAGAFPLVLGGDRSVSIGAAA
GLAKGFEDPGLIWFDAHPGLLTEETSATGCVNELPLSAILGRIPWEVPGLGRIRKEKVVL
IGTREVQAEEREWIREQGIACYTMHEIDRMGIQRVIEQAVETAGAGSGGMHVSFAADALD
PLEAPGVGSPVPGGLFYREAHFAMELLAETGAVTSMDVTGLNPLLDDQRRTGRLLAGLIA
SLLGKRIL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaactagtgaggcacaggagagcttggcggcaggacgggcgagggtccagctg
atccaggtgccgttcggcctgggagccggccgccccggggaagaacagggggccgagagc
atcgtgaaggcgggcctcgtccggatgatccgggcgctcgggcgggaggtgtccgaggag
cagatcagcggcatgtggctgcgggagacctccgggcgcccgttcactacggccaagaac
ctgccggccgtgctggagatgctggggcttgcggcccggagggtggagcaggctgtggaa
gcgggggcgttcccgctggtgctgggcggagaccgcagcgtatcgatcggagcggcggcc
ggactggccaagggcttcgaagaccccgggctgatctggttcgatgcccacccgggactg
ctgacggaggagacgagtgcgacgggctgcgtgaacgagctgccgctctccgccattctc
gggcggattccttgggaggttccgggccttggccgcatccgaaaggagaaggtcgtactg
atcggtacccgcgaagtgcaggccgaagagcgggagtggatccgcgaacagggcatcgcc
tgctacaccatgcacgagatcgaccggatgggaatccagcgggtgattgagcaggcggtg
gagaccgcaggcgccggcagcggcggaatgcacgtcagcttcgccgcggacgcgctcgac
ccgctggaggcgccgggcgtcggctccccggtgccgggcggactcttctaccgcgaagcc
cacttcgcgatggagctgctcgcggagaccggagcggtcacctcgatggacgtgaccggg
ctgaacccgctgctggacgatcagcggcggacaggccggctgctggccggcctcatcgct
tcgctgctcggcaagcgcatcttgtaa

DBGET integrated database retrieval system