KEGG   Paenibacillus mucilaginosus K02: B2K_32120Help
Entry
B2K_32120         CDS       T02041                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
pmw00040  Pentose and glucuronate interconversions
pmw00052  Galactose metabolism
pmw00500  Starch and sucrose metabolism
pmw00520  Amino sugar and nucleotide sugar metabolism
pmw01100  Metabolic pathways
pmw01130  Biosynthesis of antibiotics
Module
pmw_M00362  Nucleotide sugar biosynthesis, prokaryotes
pmw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B2K_32120
   00052 Galactose metabolism
    B2K_32120
   00500 Starch and sucrose metabolism
    B2K_32120
   00520 Amino sugar and nucleotide sugar metabolism
    B2K_32120
Enzymes [BR:pmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     B2K_32120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD Smr
Motif
Other DBs
NCBI-ProteinID: AFH65299
UniProt: I0BSF2
Position
complement(7593133..7594023)
Genome map
AA seq 296 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPVIDKPTIQYIVEEAVASGIEDLIIVTGKG
KRAIEDHFDHAFELEKNLEDKGKIDLLREVQRSARVEIHYIRQKEPKGLGHAIWCARRFI
GDEPFAVLLGDDIVQGDTPCLKQLIQEYEKSQSSVIGVQPVSLEETQRYGIIDTGTKNGR
LYEVQNLVEKPPLGKAPSNLAIMGRYVLTPRIFDFLALQETGAGGEIQLTDAIQKLSEIE
KVYAYNYSGVRYDVGEKLGYILTNLDFALKNKELNQPLLKALEELVALEEAAETIG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtaagaaaagcaatcattcccgcagcgggtctcggcacgcgttttctgcct
gcaaccaaagccatgcctaaagaaatgcttcctgtcattgataagcctacgatccagtac
atcgtggaagaagccgtcgcttcggggatcgaggatctcatcatcgtaacgggcaaaggg
aagagagcgatcgaagaccacttcgaccatgccttcgagctggagaagaacctggaggac
aagggcaagatcgacctgctccgcgaagttcagcgttccgccagagtcgaaattcactac
atccgtcaaaaagaaccgaaaggtctcggacacgcgatttggtgcgcaagaaggttcatc
ggtgacgagccgttcgccgttctgctcggggacgacatcgtacaaggggatacgccgtgc
ctgaagcagctgatccaggaatatgagaagtcacagagctccgtgatcggggtgcagccg
gtatccctggaagaaacgcagcgttacggcattatcgatacgggcaccaaaaacggccgg
ctctatgaagtacagaacctggtggagaagccgccgctcggcaaagcgccgtccaatctg
gccatcatgggccgttacgtgctgacaccgcgcatcttcgatttcctggcactgcaggag
acgggagcgggcggagaaatccagctgaccgatgcgatccagaagctgagcgaaatcgag
aaggtttatgcttataactacagcggcgtaagatacgacgtcggtgagaaattgggatac
attcttacgaacctggactttgccctgaagaacaaggagctgaaccaaccgctcttgaag
gcactggaagagctggtcgcactagaagaagcagccgaaacaatcgggtag

DBGET integrated database retrieval system