KEGG   Persephonella marina: PERMA_0522Help
Entry
PERMA_0522        CDS       T00870                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pmx  Persephonella marina
Pathway
pmx00040  Pentose and glucuronate interconversions
pmx00052  Galactose metabolism
pmx00500  Starch and sucrose metabolism
pmx00520  Amino sugar and nucleotide sugar metabolism
pmx01100  Metabolic pathways
pmx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PERMA_0522 (galU)
   00052 Galactose metabolism
    PERMA_0522 (galU)
   00500 Starch and sucrose metabolism
    PERMA_0522 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PERMA_0522 (galU)
Enzymes [BR:pmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PERMA_0522 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: ACO04658
UniProt: C0QUE6
Position
complement(473757..474635)
Genome map
AA seq 292 aa AA seqDB search
MLQVKKAVIPVAGFGTRFLPATKATPKEMMPIVDKPIIQYIVEEAVKSGIDTIIFVTGRH
KRAIEDHFDYAPELEYTLEKSGKDEYVNIIREISDMANFVYIRQKEQLGLGHAILTAQHV
IGNEPFAVLLGDELIINEEQPGIKQLIEVYQKFGKSVLGTTEVPKEETYKYGIVEGTEIE
DGIKLVNYLVEKPEPEEAPSTSAIIGRYILTPNIFDALKRTPFGKGGELQLTDALMTLRK
EEAVYAKDIEGIRHDTGNKLGYIKAIIDFALEREDTKDFIKQLIISKAKELQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgctccaggttaaaaaagctgtaatacctgttgcaggatttggaacaaggtttctccct
gcaaccaaggcaacacctaaagaaatgatgccaatcgttgataagcctatcatacagtat
atcgttgaagaggctgtaaaatcagggatagacacaataatctttgttacaggaaggcac
aaaagggctattgaggatcattttgattacgcccctgaacttgagtacacacttgagaaa
tcaggaaaggatgagtatgtgaatattatcagagagataagtgatatggcaaacttcgtt
tatataagacagaaagaacagcttggacttggacatgctatcctgacagcacagcatgtt
ataggaaatgaacctttcgccgttcttctcggagatgagcttataataaatgaagaacag
cctggaataaaacagctcatagaggtttaccagaaatttggtaaatctgtccttggaaca
acagaggttccaaaggaagagacatacaagtacgggatcgttgaaggaacggagatagag
gatggaattaagctggttaactaccttgttgagaaacctgaacctgaagaggcaccatcc
acatcagctatcatagggagatacatactgacaccaaacatatttgatgctctcaaaaga
acaccatttggtaaaggaggagagctccagcttactgacgctcttatgactttaagaaag
gaagaggctgtttatgcaaaggatatagaagggataaggcatgatacaggaaataagtta
ggttatataaaagctataatagactttgcccttgaaagggaagacacaaaagattttata
aaacagcttatcatctcaaaagctaaagaactccagtaa

DBGET integrated database retrieval system