KEGG   Persephonella marina: PERMA_0936Help
Entry
PERMA_0936        CDS       T00870                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pmx  Persephonella marina
Pathway
pmx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmx01100  Metabolic pathways
pmx01110  Biosynthesis of secondary metabolites
pmx01130  Biosynthesis of antibiotics
pmx01230  Biosynthesis of amino acids
Module
pmx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PERMA_0936 (trpC)
Enzymes [BR:pmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PERMA_0936 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth NanE QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACO04707
UniProt: C0QPX6
Position
892326..893117
Genome map
AA seq 263 aa AA seqDB search
MDILDRIILTKKRELENYSKEYLDLIDIKISKRKHPVIDFRSAFKKGRINIIAEVKKASP
SKGVIREDFDPVKIAKIYEENGAAAISVLTDKEYFKGDIQYIEQIKESGINIPVLRKDFI
IDKRQIDEAFAFGSDTFLLIARVLENEELEDLINYGRSFGMEPLIEVHTKEECEKAVSSG
GKIIGINNRDLKTFKVDINLSKELAPYLKELGADIVIAESGISTHDQIVELLGYGVDGFL
IGESLMREEDIGKKLRKLLGDTT
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
ttggacatacttgacaggataattcttacaaagaaaagagaactggagaattattcaaag
gagtatctggatcttattgatattaaaatctcaaaaagaaaacaccctgttatagatttc
agatccgcctttaaaaaaggaagaataaatataatagctgaggtaaaaaaggcatcacca
tcaaaaggtgttataagagaagattttgatcctgttaagatagcgaagatatatgaggaa
aatggggcagctgccatatcggttctcacagataaagagtactttaaaggtgatatacag
tatatagagcagataaaagagtctgggattaatattcctgtcctgaggaaagattttatt
atagataaaaggcagatagatgaggctttcgcctttgggagtgatacatttctccttata
gcaagggttcttgagaatgaagaacttgaagatctcataaattacggaagatcttttggt
atggagcctttgatcgaggtacacacaaaagaggagtgtgagaaagctgtatcgtctggt
ggaaagatcattgggataaataacagggatctgaaaacatttaaggttgatatcaacctt
tcaaaggaactcgcaccttacctaaaagaacttggtgcagatatagttattgctgaaagt
gggataagcacccatgatcaaattgtggagcttttagggtatggggttgatggattcctg
ataggtgagtccctgatgagggaagaagatataggaaaaaagctgaggaaactcttagga
gatactacttaa

DBGET integrated database retrieval system