KEGG   Persephonella marina: PERMA_1133Help
Entry
PERMA_1133        CDS       T00870                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain (SCS-alpha)(Vegetative protein 63) (VEG63)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pmx  Persephonella marina
Pathway
pmx00020  Citrate cycle (TCA cycle)
pmx00640  Propanoate metabolism
pmx00660  C5-Branched dibasic acid metabolism
pmx00720  Carbon fixation pathways in prokaryotes
pmx01100  Metabolic pathways
pmx01110  Biosynthesis of secondary metabolites
pmx01120  Microbial metabolism in diverse environments
pmx01130  Biosynthesis of antibiotics
pmx01200  Carbon metabolism
Module
pmx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pmx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pmx_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:pmx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PERMA_1133
   00640 Propanoate metabolism
    PERMA_1133
   00660 C5-Branched dibasic acid metabolism
    PERMA_1133
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PERMA_1133
Enzymes [BR:pmx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PERMA_1133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 Citrate_bind GARS_A ATP-grasp DUF3182
Motif
Other DBs
NCBI-ProteinID: ACO03617
UniProt: C0QQH3
Position
1086036..1087202
Genome map
AA seq 388 aa AA seqDB search
MKVHEHQAKEIFARYGLPVPKGYPAFTVEEAVEAAQQLGKFPVVVKAQIHAGGRGKAGGV
KLANNLDEVQKYAAELLGKTLVTFQTGPEGLPVSRIYIEEGTNIDKEFYVAITLDRSKSK
LIIMASSEGGMEIEEVAAKNPEAIITEVIDPFLGLRPYQAREIALKLGLPKNLLNKAAGL
FVKLYELYMKEDASMVEINPLVLTKEGNIVILDAKVDFDDNALFRHPDIMEMEDPTQESE
LEVKAKQYNLNYIKLDGNIACMVNGAGLAMATMDTIKLAGGEPANFLDVGGSANAEQIAN
AFKIILSDPNVKAIFINIFGGILRCDRLAEGIIQASKEVNPHVPIIVRMEGTNVELGKKM
LAESGLDLIPADTMWEGAKKAVELASKA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacatgagcatcaggccaaagagatatttgcaagatacgggcttcctgttcca
aaaggatatcctgcattcacagtcgaggaagcagttgaagctgcccagcagctgggaaaa
ttccctgtcgttgttaaagcccagattcatgctggtggaagaggaaaagcaggcggtgta
aaactggcaaacaaccttgatgaggttcagaagtatgcagctgaacttcttggaaaaaca
cttgtcactttccagacaggacctgaaggacttccagttagcagaatctacatagaagaa
ggaacaaacattgataaagagttttacgtagcgatcacacttgatagaagtaaatcaaaa
ctgataataatggcatcctcagaaggtggaatggagatagaagaggttgcagcgaaaaac
ccagaggcgattatcacagaggttatagatcctttcttaggcctcagaccgtaccaggca
agagagatagcgttaaagcttggacttcctaaaaatctcttaaacaaagcagcaggtcta
tttgtaaaactctacgagctttacatgaaagaagatgcatctatggttgagataaaccct
ctcgttctcacaaaagagggaaatatcgtaatacttgacgcaaaagttgattttgatgac
aacgctcttttcagacatcctgatattatggagatggaagatcctactcaggaatctgaa
cttgaggttaaggcaaaacagtacaaccttaactacatcaagttagatggaaatatagca
tgtatggttaacggtgcaggacttgctatggctacaatggacacaataaagcttgcaggt
ggtgaaccggcaaacttccttgatgttggaggatcagccaatgctgaacagatagcaaac
gcattcaagataatcctttcagatcccaatgtaaaagctatattcattaatatatttggt
ggaattctcagatgtgacagacttgctgaaggtataatacaggcatcaaaagaggtaaac
cctcatgtaccaataatagttagaatggaaggaacaaacgttgagcttgggaagaaaatg
cttgcagaatcaggattagaccttattcccgcagacacaatgtgggaaggtgcaaaaaaa
gctgttgagcttgcaagcaaagcataa

DBGET integrated database retrieval system