KEGG   Persephonella marina: PERMA_A0002
Entry
PERMA_A0002       CDS       T00870                                 
Name
(GenBank) hypothetical protein
Organism
pmx  Persephonella marina
SSDB
Motif
Pfam: TraG-D_C T4SS-DNA_transf TrwB_AAD_bind DUF87 DEAD DUF5788 HerA_C
Other DBs
NCBI-ProteinID: ACO04989
UniProt: C0QUT1
Position
unnamed:972..2924
AA seq 650 aa
MGIKEAVLLIPLLGYILFVRDSIRWAKRISEKDPNPKRAKYTNLFLITVSIFAIPIFMIL
VFLFSPTIGAFVWSGAALIFSFYVAYGLYGFLKSRLPNFKSKYKIEPITPEFKIFREPEI
KISASAINKHVHVLAPTGSGKTKSIVGPVLQQAIDKGLGVMSIDPKGDNEVSLACIDLLQ
KQGRLKDYWYYDVMLPNYSRSYNPLYSGIKYNNPAQLGVLIIATMPKSGGAATFYEKVQS
EFTRAMVRLLSLVNHTGKMANFIDLYSILAYLPYSIEYLLDTYQANAKFKDELAELWIKT
IAQEAAENQNFRQFLRGLQQHLALYAFTFHPKLLNSYNPEIKISEGFRQSKLMNFSLRSL
DFPSGESLDIGKMILMDLQSYAAYKTRENIQNEFPDIVIVDEAPQVIPPEFQKIFEMARG
AGIGVMVLHQSTKQFDNIQKGMFENIFTNCHVKVCLGAADRETAEFYARLLGEELKMFKT
YSRGGENVWKKPIDAILPHWNELVSERYDYRVRPEDIINMPIGEGLLIVREKDLFGVRGK
TYFFATKMEGKPWYYLPKIPYNDDWKDENLGLNLLSKFQKEFGDRIPDEDRKAVRNKKKQ
IANNIEQRADKIREELGDEIGINMVDEGIASVQNVPDELTNILGATDGML
NT seq 1953 nt   +upstreamnt  +downstreamnt
atggggataaaagaagctgtcctgttaataccacttttaggttatattctctttgtaaga
gatagtatcagatgggctaaaagaatatccgaaaaagaccctaatcctaaaagggctaaa
tatacaaacttgtttctgataacagtatctatatttgctattccaatttttatgatttta
gttttccttttttctccgactattggtgctttcgtatggtctggagctgcactgattttt
tctttttatgtagcctacggactttatggatttttaaaatcaagacttccaaactttaag
tctaaatacaaaatagaaccaattactccagagtttaagatatttagagaacctgaaata
aaaatatcggcttcggcaataaataagcatgtccatgttcttgcacctacaggttcaggt
aaaacaaaatccattgtaggtcctgttcttcaacaggctattgataaaggacttggagtt
atgagtattgaccctaaaggagataatgaagtttctcttgcctgtatagacctgcttcaa
aaacagggcagattgaaagactactggtattacgatgttatgcttcctaactattcaagg
tcttataatcccttgtatagtggtatcaaatataacaatccagcacaacttggagtttta
attatcgctacaatgccaaaatctggaggagctgcaactttttatgaaaaggttcagtct
gaatttacaagggcaatggtaaggcttctatctcttgtgaaccatacaggaaagatggct
aactttattgacctttactctatacttgcatatttaccatattcaatagaatatctactt
gatacttatcaggctaatgcaaaatttaaagatgagcttgcagaactatggataaaaaca
attgcacaggaagcagctgaaaatcaaaacttcaggcagtttttaaggggactgcaacag
catttagctttatatgcttttacattccatcctaaattgctgaactcatacaacccagaa
ataaaaatatctgaaggttttagacagtctaaacttatgaacttttctttaaggtctttg
gattttccatctggagagagtttggatataggaaaaatgatattaatggacttgcaaagc
tatgcagcatataagacgagagagaatatacaaaatgaatttccagatattgttatagtt
gatgaagcaccacaggtaataccacctgaatttcaaaagatatttgaaatggcaagagga
gcaggtattggagttatggttctgcatcaatctaccaaacagtttgataatattcaaaaa
ggaatgtttgaaaatatatttacaaactgccatgtaaaggtttgcttaggagctgcagat
agggaaacagctgaattttatgcaaggctacttggtgaggaactaaagatgtttaagact
tattcaagaggtggagaaaatgtatggaaaaaaccgatagatgccatacttccacactgg
aatgagcttgtatctgaaagatacgattacagagtaagacctgaagatattatcaatatg
cctattggggaaggtttacttattgttagggaaaaagatttgtttggtgttcgtggtaag
acctatttctttgcaacaaaaatggaaggaaaaccttggtattacctgcctaaaatacct
tacaatgatgattggaaagatgaaaatcttggcttgaatttgctttcaaagttccagaaa
gagtttggagatagaatacctgatgaagatagaaaggcagtaaggaataagaaaaaacag
attgcgaataatattgaacaaagagctgataagattagagaggaacttggggatgagata
ggaataaatatggttgatgaaggtatagcttcagtgcagaatgttcctgatgaactaact
aatatattgggggctacagatggaatgctttaa

DBGET integrated database retrieval system