KEGG   Persephonella marina: PERMA_A0019
Entry
PERMA_A0019       CDS       T00870                                 
Name
(GenBank) hypothetical protein
  KO
K12058  conjugal transfer mating pair stabilization protein TraN
Organism
pmx  Persephonella marina
Brite
KEGG Orthology (KO) [BR:pmx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmx02044]
    PERMA_A0019
Secretion system [BR:pmx02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PERMA_A0019
SSDB
Motif
Pfam: TraN DUF5016
Other DBs
NCBI-ProteinID: ACO04961
UniProt: C0QUU8
Position
unnamed:complement(11386..13944)
AA seq 852 aa
MHRSKSVIILQLIAFISFSFAAVITESTKTTCPADPTFGGKCHLKEVRNDGPSCKTINGV
EVCRNWWKKEYVYECEGQDNSALFSTFENQSYCRLVSRCKTWEDVSLKGGNVSCRIYIDK
NRPGCETNPNRAECVADDCGDIKNKCTFLEYIPFGNIPDKANTTSQYTCDAYGTTCGYVQ
VPTSSGINLGTYVYECPSDVRKVCREYEQVLKCPAECPDGTKVDCPDNSNQATCPDGSIA
TCKTETCNTTKTCIQYETVNVQGTEIKTCLAPRSYTEYKVEAGSQQAQDLANNPSCIKVS
DDITPCPYSTRTYGNTTICELAGRHSNIGGSSGQVFIGRNIQVPDGTDLVVYIYTGNSCD
DDNTRVDAFIKDSRTGQIIGEKHTSCSINGQVFTLYRNTRNLTIDYKLKIVHCIGSGCGS
NDYNFSDTETSTSWNYGGSTWDSHDSSLGWKVYHWETYRCYTDTIDTSSCSSFSSNCTLQ
DNLNDLSSLACNKFAIDINNSNKNVCSEFAIQYECPATITKQQCVKYETKSVCNGVSYPV
RSVEVENKDFSNEFNKAMALAQLANELKHVWAGKYMRCDSGWFSSVFENPMDYFKQKMVS
FIVMQLGAQFLSAATTFVQDYLGSCLSPAVAGVDFATTGDATAVSQESVADCMGSAAGQA
WADAGDNSMMQSMLEKMGLNSGAASFLASPYGQLAISVAIDIFTQTNKCNACTSKSCAEA
HGFYNTYGLIKGGNCHYVESGCAWKVKYGIGSVCLRKKYMYCCYDSVFARILVEQAYKQL
GYSFAGGNCSALTFDDIKNLDFSSMDFTELQNYLEAKMKGQIDPNLIKNKINSYFDSDYG
TQTFTGETPYSN
NT seq 2559 nt   +upstreamnt  +downstreamnt
atgcacagaagtaaatcagtaataatactgcaattaattgcttttataagtttttcattt
gcagctgtaataaccgaaagcactaaaacaacctgtccagcagaccctacattcggggga
aaatgccatttaaaagaagtaagaaatgacggaccatcctgtaaaacaataaatggtgtt
gaagtttgtaggaactggtggaagaaagaatatgtatatgaatgcgaaggacaggataac
tcagctttattcagcacatttgaaaatcaaagttattgcagacttgttagtagatgtaaa
acttgggaagatgtgagcctaaaaggtggaaatgtatcttgtagaatatacatagataaa
aatagaccgggatgtgaaaccaatcccaatagagctgaatgtgtagcagatgactgcggg
gatataaaaaacaaatgcacctttcttgaatacataccttttggaaatattcctgataaa
gctaacacaacaagtcaatatacctgtgatgcctatggaactacatgtggttatgtccaa
gtgccaacttcaagtggaataaatcttggaacttatgtttatgagtgtccctcagatgtt
aggaaagtttgtagagaatatgaacaggtattaaaatgtccagctgaatgtccagatgga
actaaagttgattgtcccgataattcaaaccaagcaacctgtccagatggaagcatagca
acatgcaaaactgaaacatgcaatactacaaaaacttgcattcaatacgaaactgtaaat
gttcaagggacagaaataaaaacttgcctcgctccaagaagctatacagaatataaggtt
gaagcaggtagtcaacaagctcaagatttagctaacaacccaagctgtataaaagtatca
gatgacataactccttgtccttactcaacaagaacctatgggaatactactatatgtgaa
cttgcaggtaggcatagtaatataggtggtagttcaggacaagtattcattggaagaaat
attcaagttcctgatgggactgatttggttgtttatatatatacaggaaactcttgtgat
gatgacaatacaagagtagatgctttcattaaagatagcagaacagggcaaataatcggt
gaaaaacatacaagctgttctataaatggacaagtctttactctatacagaaatacacga
aacttaactattgattacaagctcaagatagtccactgtataggttctggttgcggaagc
aatgactataacttttcagatacagaaacatcaacaagctggaattatgggggttctact
tgggatagccacgacagcagtttaggctggaaggtgtatcactgggaaacttacagatgt
tatacagatacaattgacacttcaagctgttcatcctttagtagtaattgcacacttcaa
gataatctcaatgacctatcatctttagcctgtaataaatttgcgatagacataaataac
tcaaataaaaatgtatgttcagagtttgccattcagtatgaatgtccagcaaccataact
aaacagcaatgtgtaaagtatgaaactaaatctgtttgtaatggagtatcgtatcctgta
agaagtgtagaggttgaaaacaaagacttttcaaatgagtttaacaaagctatggcttta
gcacaattagccaatgagttaaaacatgtatgggctggaaaatatatgagatgtgatagc
ggatggtttagttcggtctttgaaaaccctatggactatttcaagcaaaaaatggtttct
ttcattgttatgcaattaggggctcaattcctgtcagccgcaacaacttttgttcaggac
tatttaggttcttgtctctctcctgccgttgctggagttgattttgctactactggagat
gcaacagcagtatcacaggaaagcgtagctgactgcatgggaagtgccgctgggcaggct
tgggctgatgctggagacaacagtatgatgcaatcaatgcttgagaaaatgggactaaat
agtggtgcagcttcattcttagcaagtccttacggtcagcttgctatatctgttgcaata
gatatttttacacaaacaaacaaatgtaatgcctgcacatcaaaaagttgtgcagaagca
catgggttctataacacttatggattaatcaaaggtggaaactgtcattatgtagaaagt
ggctgtgcttggaaggttaaatacggcataggttctgtatgcttaagaaagaaatacatg
tattgttgttatgatagtgtatttgccagaatacttgtagagcaggcatataaacagctt
gggtattcctttgcaggcggtaattgttcagcattgacttttgatgatataaaaaacctt
gacttttcatctatggactttactgaactacaaaactatcttgaagcaaaaatgaagggg
cagatagaccccaacttaatcaaaaataagataaacagctactttgatagcgattatgga
actcaaacctttactggagaaactccatatagtaattag

DBGET integrated database retrieval system