KEGG   Persephonella marina: PERMA_A0023
Entry
PERMA_A0023       CDS       T00870                                 
Name
(GenBank) putative TraU
  KO
K12060  conjugal transfer pilus assembly protein TraU
Organism
pmx  Persephonella marina
Brite
KEGG Orthology (KO) [BR:pmx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmx02044]
    PERMA_A0023
Secretion system [BR:pmx02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PERMA_A0023
SSDB
Motif
Pfam: TraU CSS-motif
Other DBs
NCBI-ProteinID: ACO05006
UniProt: C0QUV2
Position
unnamed:complement(16016..16990)
AA seq 324 aa
MTLISSFSISLAATPPCINPISTVDWSFFADTIEFKGTCVCSTSGAIKVGVKLQLAEPIA
FIETPNKAWDFICFGSTRDKFSVQKKDGTNLGKKGAKTNAHYIKYPVFGVLNITFDNLCT
MHDLEFDIIPTGLSEINPLLWDDELAMIAQPWKLLFANPIAQVLCLADCVSSSVVFPSNV
DTFETVRNGLFYCAGCWGAIQPNTTTTRGKDSVVESALTAVKLIDLLHESLQLKVYKEVS
GLGWASNFSSGFPIPSDVACQPKFFPVIVKSQYWLNLSYPVAWDAIPIGDFPPKWSWFKK
YPSKEENIWTIWRIRNCCLGFQFP
NT seq 975 nt   +upstreamnt  +downstreamnt
atgacactaataagtagctttagtataagtttagccgctacaccaccttgtattaatccg
atttcaacggttgactggtctttctttgcagacacgatagagtttaaaggaacttgtgta
tgttctacatctggagctataaaagttggagtaaaacttcagcttgcagaacccattgcc
ttcatagagacaccaaacaaagcatgggattttatttgttttggttctacgagagataaa
ttctctgttcagaaaaaggatggaacaaatttaggcaagaaaggggctaaaaccaacgca
cattacataaaataccctgtttttggcgttctaaatataacatttgataacctctgcact
atgcatgatttagagtttgatattattcctaccggtttatcagagataaaccctttacta
tgggatgatgaactggctatgattgcccaaccttggaaattactatttgcaaatccaata
gcacaggttctatgtcttgctgattgtgtttcaagttcagtagtttttccttcaaatgta
gatacatttgaaacggttagaaatggacttttctattgtgctggttgttggggggcaata
caacccaacaccaccacaaccagaggtaaggatagtgttgtagaaagtgccttaacggct
gtaaagctaatagacctgcttcatgaaagcctgcaactcaaagtctataaagaagtatct
ggtcttggatgggcaagtaatttttcaagcggttttcctatcccttctgatgtagcatgt
caacctaaattctttccagttattgttaagagccaatactggcttaatctttcctaccct
gtggcttgggatgcaatcccgattggagactttccacccaaatggagctggttcaaaaaa
tatccatcaaaagaggaaaacatctggactatctggaggattagaaattgctgtttagga
tttcaatttccttaa

DBGET integrated database retrieval system