KEGG   Persephonella marina: PERMA_A0024
Entry
PERMA_A0024       CDS       T00870                                 
Name
(GenBank) hypothetical protein
  KO
K12061  conjugal transfer pilus assembly protein TraW
Organism
pmx  Persephonella marina
Brite
KEGG Orthology (KO) [BR:pmx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmx02044]
    PERMA_A0024
Secretion system [BR:pmx02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PERMA_A0024
SSDB
Other DBs
NCBI-ProteinID: ACO04949
UniProt: C0QUV3
Position
unnamed:complement(16974..17585)
AA seq 203 aa
MRKIISIFLSLGLIGFGYSLENLGTFGKVYQIEEEDIIEYIKKNAKPPKFSREYIQRKIH
AAAQVDVNLPVNKRDNVRYEKIIYTVPNDIIIEGKLIAKKGTKINVLKEIKLHNTYVILA
DYMLPYFLDWNKKTNAVYLITQGNILDLQKKYPDLRIYAGFPKVLSSLKVKSIPSIVYQY
QDKLVILEKGFPNDKKSVDDTNK
NT seq 612 nt   +upstreamnt  +downstreamnt
atgaggaagataatatctatatttttatcactgggcttaataggttttggctattcactg
gaaaatttgggaactttcggaaaggtctatcaaattgaagaggaagacattattgaatac
ataaagaaaaatgccaaaccacctaaattctccagagaatatatccagcgaaaaatacat
gcagctgcacaggtagatgtcaatctacctgttaacaaaagagataatgttagatatgaa
aagataatatacacagttcctaacgacataataatagaaggaaaactcatagcgaaaaaa
ggaacaaaaataaatgttttgaaagaaattaaactgcataacacctatgtaatccttgca
gactatatgcttccttattttttagattggaataaaaaaaccaatgctgtttatctgata
actcaaggaaatattcttgatttgcaaaagaaatatccagacttaaggatttatgctggt
tttcctaaagtgctttcaagtttaaaggttaagtccataccttctattgtttatcagtat
caggacaagcttgtaattttggaaaaggggtttccaaatgataagaaaagtgttgatgac
actaataagtag

DBGET integrated database retrieval system