KEGG   Persephonella marina: PERMA_A0031
Entry
PERMA_A0031       CDS       T00870                                 
Name
(GenBank) putative membrane protein
  KO
K12056  conjugal transfer mating pair stabilization protein TraG
Organism
pmx  Persephonella marina
Brite
KEGG Orthology (KO) [BR:pmx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmx02044]
    PERMA_A0031
Secretion system [BR:pmx02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PERMA_A0031
SSDB
Motif
Pfam: TraG_N DUF2894
Other DBs
NCBI-ProteinID: ACO04997
UniProt: C0QUW0
Position
unnamed:complement(20265..23756)
AA seq 1163 aa
MAIDLDLYTVGNIETLSQVYKYLVLILGDSFIGTVIKITAVWGLIFAILASAFKGRFSIW
IYHFLMTYVLFQIFFMPVVRLTIIDTKLDRTYVVDNVPFGVGFIASMASGFSYKLTNLID
NAFHTGTVVVWGPGTGSYVAGVDYSRMGFAGMFDYLKMGLKIDPRLVQTKFNAVYEMQAY
IEQCFFPYVSTLSATEIDNLRKSNNLLADLRVDNSFLMSYNGTTWTCDDFYDNKLVPDWN
DFVNTGATTPQLFGFADYMTVRMVDSINAMTNASMSFNQIITQSGIINMIKESYFTSGLA
DDMNNRLLAGYAVGRAEEQAKLMGKAMFLWAKKVIPFMQGFLEAFFVILFPFLIILLFIP
LVSFGGVQPAIGYLKVIVWVYLFIPILAIIDGMIKLQAINKTIAWLNSVGLQGITLGDYG
FLLEQADFYPAIAGFAAMSTPLWAWMLLKGFEAGVHGISALVGSMGSQFVGQEAGAANIT
RNMTRDSRELMANMGAGQSPVEALSNAGTWMYKENTNLGGLYSSLGAYNAHSILESQLGI
GGAVQTTTAQALYGLTHSGGRGMAAWNASGGNVMNMLNTGAMTSPAQIIERDYGTLGLKY
DAQGNLVAAEFNTGIKSDMMQANLQTTFSQSRNDVISTAWNAVWGNSQTYQKAYQSTSAI
TEQFLKDYTSGTGIEDRASFDNRAEVKEAFTDAKELRDTLTEEYGLSKDKANQFVAEFTT
GLSAAAAKNGGKLDINTVKDVFKSVLSKFKADGSVGAKGIENFEETEAWKEATQYADNKS
YQIVQDTALSYTTSHNAYFNRVKQEKGAELQDVSYQDLQQFHENWQKAEQITAQINRAFN
QTQTELGSLNTNNLIGFIRWMNGGHIDKQKETMMMDRILTAVANNDKPFLDNLSKAYTAY
VMEMQGMTDVSPGVSKFFTQKQAFLNMVQGQVDNAAVNIATHFNQHYEGINTLRNMAGVS
PYQNLQAEAGDRFAYVGSNQASIENGVYAGKGNIKPISKPQWTGEVEQYTKDPTNPIELG
KNIVNYGKEHGAWGTAMAVGTGSVILGTAMEYAPWAKQAFDTMKSGASKVWTTIRTAEPI
AEMGTGRWAQFAAGGRLLTIPVGTTAGVAMAATTVPLAAVGGWAIGTAINNKWGDDIYNN
FTEPVLDWIGEKTGWWKPVGGNK
NT seq 3492 nt   +upstreamnt  +downstreamnt
atggctattgatttagacctttatacagttgggaacatagaaaccttatcacaggtatat
aagtatctggttttaatactgggtgatagttttataggaactgttataaaaatcacagct
gtatgggggctgatttttgccattcttgcttctgctttcaagggtcggttttccatctgg
atatatcatttcttgatgacctatgttcttttccagatattctttatgcctgttgttcgg
cttaccatcatagatacaaagcttgatagaacttatgttgtggataatgtgccttttgga
gtgggttttattgcttcaatggcaagtggattttcttataaacttacaaacctaatagat
aatgcttttcatactggaactgttgttgtctggggaccgggaactggtagttatgtggca
ggcgttgattattccagaatgggctttgctggaatgtttgactatttaaagatggggcta
aaaatagacccacggcttgttcaaacaaaatttaatgctgtttatgaaatgcaagcttat
atagaacagtgtttctttccttatgtgtcaaccttaagtgcaacggaaatagataatctt
agaaaaagcaataacctgttagcagatttaagagtagataattctttccttatgagttat
aacggcactacttggacttgtgatgatttttatgacaataaactcgttcctgattggaat
gattttgtaaatactggagctactacaccacaactctttggctttgcagactatatgact
gttcgtatggttgatagtatcaatgcaatgactaatgcaagcatgtcatttaaccagata
attacccagtcaggaattatcaatatgataaaggaaagctattttacttctggtcttgcc
gatgacatgaataatagactacttgctggatatgctgtcggtagggctgaagaacaggca
aagcttatgggtaaagcaatgttcttatgggctaaaaaggttattccatttatgcaaggc
ttccttgaggcattctttgtaattctgtttccgtttttaataatcttattgtttatacca
cttgtttctttcgggggtgtccagccagctattggataccttaaggtgatagtatgggtt
tatctttttattccgattttagcaataatagatggaatgataaaactacaagctataaat
aaaacaatagcttggcttaattctgttggacttcagggtattacacttggagactatggg
ttcttgttggaacaggcagatttttatcctgcaattgctggatttgccgcaatgtcaact
ccactttgggcttggatgctattaaagggttttgaggcaggagttcatggaattagtgca
ttagtaggttctatgggaagtcaatttgtaggacaggaagctggagctgcaaacataaca
agaaatatgacaagagacagcagagagcttatggcaaatatgggtgctggtcaatctcca
gtagaggcgttatccaatgcaggaacttggatgtataaagaaaatacaaatttaggcggg
ttatatagcagtttaggtgcttataatgcacattctattttagaaagtcaacttggcatt
ggaggggctgttcagacaacaacagcacaagctttatatggacttacacactcaggtggt
agaggtatggctgcttggaatgcctctggtggaaatgtaatgaatatgctaaatactgga
gctatgacttcaccagcacaaatcatagaaagagactatggaactcttggtcttaaatat
gatgcacaaggaaacttggtagccgctgaatttaatacgggaataaaatcagatatgatg
caagcaaacctgcaaacaacattttctcaatccagaaacgatgttatatcaactgcttgg
aacgcagtctggggtaatagccagacatatcaaaaagcttatcaatctacatctgctata
acagagcagtttttaaaagactacacatctggaacgggtatagaggatagagcttcattt
gataatagggcagaagtaaaagaagcctttacagatgcaaaagagttaagagatacacta
acggaagaatatggactatcaaaagataaagctaatcagtttgttgcagaatttacgaca
gggttaagtgcagcagctgctaaaaacggcggtaagttggatattaataccgttaaagat
gtatttaaaagtgttctatctaaatttaaagcagatggttctgttggtgctaaaggaatt
gaaaattttgaggaaacagaggcttggaaagaagctactcaatatgcagataataagtcc
tatcaaattgttcaagatacagctttatcatatacaacaagtcataatgcatatttcaac
agggtaaaacaagaaaaaggagcggaacttcaggatgtttcttatcaagacttacaacag
ttccatgagaattggcaaaaagcagaacagattacagcacaaattaatagggcatttaat
caaacacaaacggagcttggaagtttaaatacaaataacctaataggatttattagatgg
atgaatggaggacatatagataagcagaaagaaactatgatgatggatagaattcttaca
gctgtggctaataatgacaagccatttttagataatttgtcaaaagcctatactgcttat
gttatggaaatgcaagggatgacagatgtatctccaggggtatcaaaatttttcactcaa
aagcaggctttcctaaatatggttcagggtcaggtagataatgccgcagttaacatagct
actcattttaatcagcactacgaagggataaatacactaagaaatatggcaggtgttagt
ccataccagaaccttcaagctgaagctggagacagatttgcttatgttggttcaaatcaa
gcaagtattgaaaatggtgtttatgctggaaaagggaatataaagcctatcagtaagcct
caatggactggagaagtggagcaatatacaaaagaccccacaaatccgatagagcttgga
aaaaacatagttaactatggaaaggagcatggggcttggggaactgcaatggctgtggga
actggaagtgttattttgggaactgctatggaatatgcaccttgggctaaacaagcattt
gatacaatgaaaagtggagcttcaaaagtatggacaactattagaactgctgaaccaata
gcagaaatgggaacgggtagatgggcacagtttgcagctggaggcaggttattaactatt
cctgttggaactactgctggtgtagcaatggcggcaacgacagttcctcttgcggcagtg
ggaggctgggcaataggaacagctataaacaataaatggggagatgacatttataacaac
tttactgaaccagtcttggactggattggtgaaaaaacaggatggtggaaaccagtagga
gggaacaagtga

DBGET integrated database retrieval system