KEGG   Persephonella marina: PERMA_A0037
Entry
PERMA_A0037       CDS       T00870                                 
Symbol
traC
Name
(GenBank) type-IV secretion system protein TraC
  KO
K12063  conjugal transfer ATP-binding protein TraC
Organism
pmx  Persephonella marina
Brite
KEGG Orthology (KO) [BR:pmx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmx02044]
    PERMA_A0037 (traC)
Secretion system [BR:pmx02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PERMA_A0037 (traC)
SSDB
Motif
Pfam: P-loop_TraG TraC_F_IV AAA_10 DUF5934 CARD_2 TraG-D_C
Other DBs
NCBI-ProteinID: ACO05012
UniProt: C0QUW6
Position
unnamed:complement(28176..30956)
AA seq 926 aa
MITKIKELFLGENLEKYGTERRIINALIRNRVRAADYISVLEEKDNIFLTKEGFGFAFYL
TLPAFLGQRQEEAFETFLNHDYPDGTVINFMAFSSSNIKPFLDYWEQEHSAENVDIDNPG
ILKYIIKKRKEYLLNAVNNSFWEDVEAKPRIIYNIMSVHIPFESDNPDVVRIQFRRIRKL
ANRIREAIRAEGFGCDFANADMMLAIYKEILNPELQGAIKYQKGLDFNRQVLDRNTTLRL
VGGLESDLEVANDEKKKYWRGFWFSQYPNEMTLWKFSNILFPYDDTNPSPIIPTDFFMCM
QVKVEDIEKRQTKITAKAIQMQDQAEKSEFARWIPKIKRRGEYAKYIKEVIEDGKVPYSA
SMYLFISADNPEHLDDIASGAVQRFVSKKFKLAREIDASLFNVLMECLPLNQIKEREEFF
INYSTLFDANIASLMPFQGTSLGSKRPITLYLDRKYSLWGFDPFHSDTNFNIVKIAASGG
GKSFSENDFHVLNLSAGRKIRVIDIGWSYKPLCSLLGGEYIELDDERNPCFNPFTHIIED
EKGNIHEDELAVLIPFVGLLAGLDLNPEALISNEDNLMARYCSFIARAITNAYKSYGNKT
GLKEVVEELQKLEDDTGDNIPQKLSQALYEFSHGHYARYFNGENNIHYSKDYVVLELEQI
ENKDPRLKQAILYSLILRIFREFFLAHLRKDYSRKFLVVDEAWSILRESKAGYFLETAAR
RFRKYGCSLVVITQKIEDLLASPATRAIYANSAHLMILKPSEQDIEDAKSEKRLPVSDFE
KELILSLTTVPGKFSELIIRNSVLGTVVGRLIVDRYSYWTFTTNDAERRVRTELLEELKN
YELVLETLAKRMPIGEILEKLGYITGEQKQLILWLQSNHPKYKGKLFGEIATELGFVSKE
KVIEATEKQKNISLQLKQLVEAYKKK
NT seq 2781 nt   +upstreamnt  +downstreamnt
atgataactaaaatcaaggagctgtttttaggggaaaatttagaaaaatacggaactgaa
agaagaataattaatgctttgataagaaacagggtaagagccgcagactatatttctgtt
ttggaagaaaaagacaatatatttctgaccaaagaaggttttggctttgcattttacttg
acacttccagcttttcttgggcaaagacaggaagaagcctttgagacattcttgaaccat
gattatccagacggaacggtaataaactttatggctttttcatcttcaaacataaagccg
tttttggattattgggaacaggagcatagtgctgaaaatgtagatatagataaccccggt
attctgaagtatataatcaaaaaaagaaaagaatacctgctaaatgctgtaaataatagc
ttttgggaagatgtagaggcaaagccaaggataatatacaacatcatgtcggttcatatt
ccttttgaaagcgataatcctgatgtggttaggatacaattcaggagaataaggaaactt
gcaaacagaataagggaagcaataagggcagaaggtttcggatgcgattttgcaaatgct
gatatgatgcttgcaatttacaaagagatattaaatccagaacttcaaggagctattaaa
tatcaaaaggggcttgattttaatagacaggttcttgacagaaacacaacactacggctt
gtaggtgggctggaaagtgatttagaggttgcaaatgatgagaaaaagaaatactggaga
ggcttctggtttagccagtatccaaatgaaatgacattgtggaaattttccaatattttg
tttccttatgatgatactaatccaagtccgattatacccactgattttttcatgtgtatg
caggtcaaggtagaagatatagaaaaaaggcaaacgaaaataaccgcaaaagctattcaa
atgcaagaccaagctgaaaaatcagagtttgcaagatggataccaaagataaaaagaagg
ggagagtatgccaagtatataaaagaagttatagaagatggtaaagttccttatagtgct
tccatgtatctgtttataagtgcagataacccagagcatttagatgatatagcctctgga
gctgttcaaagatttgtttcaaagaaatttaagcttgcaagggaaatagatgcctcactt
ttcaatgtattgatggaatgtttacccttaaaccagataaaagaaagagaagaatttttt
attaactattccactttgtttgatgcaaatatagcttccttaatgccatttcaagggaca
agtttaggttctaaaagaccaataactctatatctggataggaaatacagcctttgggga
tttgacccttttcattcagacacaaatttcaatatcgtaaagatagccgcttctggtggt
ggtaaatctttctcggaaaatgacttccacgtgcttaatctgtcagctggtagaaaaata
agagttatagatataggatggtcctataaaccactttgtagtcttttaggtggtgagtat
atagaacttgatgatgagagaaacccttgttttaatccatttactcatattattgaagat
gaaaaaggaaatatccatgaagatgaacttgccgtattaatcccatttgtcggactactt
gcaggtttagatttaaatcctgaagctctcatatcaaatgaagataacttaatggcaaga
tattgttcattcatagcaagggctattacaaatgcttataaaagctacggcaacaaaaca
ggtctgaaagaagtagttgaggaactgcaaaaacttgaagatgatactggagacaatatt
ccacaaaaactatctcaagccttgtatgagttttcacatgggcattatgcaagatatttc
aatggtgaaaataatatccactattcaaaggattatgttgtattagaacttgaacagata
gaaaacaaagacccaaggctaaaacaggctattctttattcattaatactacggatattt
agagaatttttccttgcacatttaaggaaagactactcaagaaaattccttgtcgttgac
gaggcgtggtcaattttaagagagagcaaagctggatatttccttgaaacagctgcaaga
agatttagaaagtatggttgttctcttgtagttattacacagaaaatagaggacttgctt
gcttctccagcgacaagggcaatatatgcaaactctgcacatcttatgatactaaagcct
tcggaacaggatattgaggatgcaaagagtgaaaaaaggcttcctgtatctgattttgaa
aaggaactgatactatctcttactaccgttccagggaagttttcggagttaatcataaga
aactctgttctgggaactgttgtaggtaggttaatagttgacagatactcatactggaca
tttacgacgaacgatgctgaaagaagagttagaaccgaattattggaagaattgaaaaac
tatgagcttgttctggaaacactggctaaaagaatgccgataggggagatactggaaaaa
cttggatacattactggagaacaaaaacagctaattttatggcttcaatccaatcatcca
aaatataagggtaagctatttggagaaatagctactgaacttgggttcgtcagcaaagaa
aaggttatagaagcaacagaaaaacaaaaaaacatatcactccagctaaaacaacttgta
gaagcctataagaagaagtag

DBGET integrated database retrieval system