KEGG   Persephonella marina: PERMA_A0038
Entry
PERMA_A0038       CDS       T00870                                 
Symbol
traV
Name
(GenBank) type IV conjugative transfer system protein TraV
  KO
K12064  conjugal transfer pilus assembly protein TraV
Organism
pmx  Persephonella marina
Brite
KEGG Orthology (KO) [BR:pmx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmx02044]
    PERMA_A0038 (traV)
Secretion system [BR:pmx02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PERMA_A0038 (traV)
SSDB
Motif
Pfam: TraV DUF1521 DUF2815
Other DBs
NCBI-ProteinID: ACO04991
UniProt: C0QUW7
Position
unnamed:complement(30946..31461)
AA seq 171 aa
MKRHVLALIFVVPFLTGCSSILGIGHENFRCEGTDKGGVCAPVDKVYKDRHLLGNQKDTV
IDREKEKEISEEKEEGVFYEGCYGEVKISKDGKPKCNLKPKAEIKVRVIKEKPFAQPIRI
QPKIAKIWIQPYVDENGNLVDGRYIYVIVKKGGWLLPDGTKIYDDEVKDDN
NT seq 516 nt   +upstreamnt  +downstreamnt
atgaaaaggcatgtgttggcattaatctttgtagttccattcttaacaggttgcagttct
atactgggtataggacatgaaaacttccgatgtgaagggacagacaaagggggagtttgt
gcacctgttgacaaggtttataaggatagacatctgcttggaaatcagaaggatacagtg
atagatagggagaaggaaaaagaaatttcagaggaaaaagaggaaggagtattttatgaa
ggttgttatggggaagtaaaaatttccaaagatggaaagcctaaatgcaatttgaaacca
aaagcagagataaaggttagggttataaaggaaaaaccatttgcacagcctattagaata
cagccgaaaatagcaaaaatctggatacagccgtatgtggatgaaaacggaaacttggta
gatggtagatacatctatgtaatagttaaaaaaggcggttggcttttacctgatggaaca
aaaatttatgatgatgaggtaaaagatgataactaa

DBGET integrated database retrieval system