KEGG   Persephonella marina: PERMA_A0042
Entry
PERMA_A0042       CDS       T00870                                 
Name
(GenBank) TraB pilus assembly family protein
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
pmx  Persephonella marina
Brite
KEGG Orthology (KO) [BR:pmx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmx02044]
    PERMA_A0042
Secretion system [BR:pmx02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PERMA_A0042
SSDB
Motif
Pfam: TrbI RIC3 DUF2721 DUF2316 Mito_fiss_reg
Other DBs
NCBI-ProteinID: ACO04960
UniProt: C0QUX1
Position
unnamed:complement(32848..34098)
AA seq 416 aa
MEEKKNSQNVEEKEEIKEEVETIEDRLNKKRMVILGAITAGISLFVIFSFFSNVIFGLAD
NTSVPQYQPKKEGEKTIAPKVEEDWKAITEMKINQLQERLQRMEDTNKQILQLLQEQKQE
REMLREEIEREIEERVKTTPSASVPPPPPQTPVQYGQPQGQQGQQGQQQKAPALKEFKPD
KEEETDKKEVSKTEKKEKKAVKIKLPLGFLKGLTLTGLDAPTFQYGQNNPHPVLIVSLSK
QIIANNKKLNLKECFFLGSGFGEISSERAYIRLVKLSCIDKKGNVLEQKVAGWVLDDDGK
VGLRGRVVSKQGAVLAKTFMAGLLEGLSRTIAATSTTIQISPVGTTQTLNPQDATKVALA
SGFQSAASRLAQFYMKIAEQMYPVVEVSPGRKITILISGGSLEKTKDNKLISNPLK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggaagagaagaaaaatagtcaaaatgtagaagaaaaggaagaaataaaagaagaagtt
gagacaatagaggacaggctaaataaaaaaagaatggttattctgggggcgattactgct
ggaatatctctatttgtaatattctctttcttttcaaatgttatatttgggcttgctgac
aatacatcagttccccagtatcagccaaagaaggagggagaaaaaaccatagcaccgaaa
gttgaggaagactggaaagcgattacggaaatgaaaataaatcagcttcaggaaagactg
caaagaatggaagatacaaacaagcaaattctccagctactccaagaacaaaaacaggaa
agagaaatgctccgtgaggaaatagaaagggaaatagaggaaagagttaaaaccactcca
tctgcttcagttccaccaccaccaccacaaacaccagttcagtatggtcaaccgcaaggg
caacagggacaacagggacaacaacaaaaagcaccagctttaaaggaatttaaaccagac
aaagaggaagaaacagataaaaaagaagttagcaaaacagaaaagaaagaaaagaaagcc
gttaaaataaaacttccacttggatttttaaaaggtcttacattaacaggtcttgatgct
ccaacattccagtatggacagaataatccacatccagttttgatagtatctctttcaaag
cagataatagcaaacaataaaaaattaaatctaaaagaatgtttctttttaggttctggt
ttcggagaaatctcaagtgaaagggcttatatcaggcttgtaaagttatcctgtatagat
aagaaaggaaatgttttagagcaaaaggttgctggatgggttcttgatgatgacggaaaa
gtaggcttgagaggcagagttgtaagtaagcagggagctgttttagctaaaacatttatg
gcagggcttcttgaaggtttatccagaactatagccgctacatcaacaacaatacaaata
tctccagtagggaccacgcaaactctaaatccgcaggatgcaacaaaggttgcacttgca
agtggttttcagagtgcagcttcaagacttgcacagttctacatgaaaatcgcagagcag
atgtatccagtagttgaagtatctcccggtagaaagataacaatacttatatctggggga
agccttgagaaaactaaagataataagcttattagcaatcctcttaagtag

DBGET integrated database retrieval system