KEGG   Persephonella marina: PERMA_A0045
Entry
PERMA_A0045       CDS       T00870                                 
Symbol
traE
Name
(GenBank) type IV conjugative transfer system protein TraE
  KO
K12067  conjugal transfer pilus assembly protein TraE
Organism
pmx  Persephonella marina
Brite
KEGG Orthology (KO) [BR:pmx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmx02044]
    PERMA_A0045 (traE)
Secretion system [BR:pmx02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PERMA_A0045 (traE)
SSDB
Motif
Pfam: TraE DUF3425
Other DBs
NCBI-ProteinID: ACO04985
UniProt: C0QUX4
Position
unnamed:complement(35294..35821)
AA seq 175 aa
MKYIERWSELYRKNAILLFVVFLQAVLIVFLLTAVLYLAVKRTAVIAIPPTGTQIATGSE
THRLLWGRYYIDLLMNFSKNDIDNRLNILFTFIQNPKARERLIREAEEIKKNDIVQVFIP
YESTWKVQGGVVSVKGHIKRWIGTTLVRDEDVLVKVKLRPSGSIIALEDWKYEKP
NT seq 528 nt   +upstreamnt  +downstreamnt
atgaaatatatagagagatggtcagagctttatcgtaaaaatgctatattacttttcgta
gtttttctgcaagcggttcttatagtttttctactaacagcagtattatatttagcggtt
aaaaggacagctgttatagccattccaccaacaggaactcaaatagcaacaggtagcgaa
acccacaggcttttatggggaagatattacatagaccttttaatgaacttctcaaagaat
gatattgataaccgactaaacatcctctttacatttatccaaaatccaaaagcaagggaa
aggctaataagagaagcagaagaaataaagaaaaatgatattgttcaagtatttatccct
tacgaaagcacatggaaagttcaaggtggtgttgtttcggttaaagggcacatcaaaaga
tggatagggacaactcttgttagagatgaagatgtgcttgtgaaggtgaaacttagacca
tcggggtcaattatagcactggaggactggaaatatgagaagccttaa

DBGET integrated database retrieval system