KEGG   Pseudomonas mendocina ymp: Pmen_0071Help
Entry
Pmen_0071         CDS       T00510                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00260  Glycine, serine and threonine metabolism
pmy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmy01100  Metabolic pathways
pmy01110  Biosynthesis of secondary metabolites
pmy01130  Biosynthesis of antibiotics
pmy01230  Biosynthesis of amino acids
Module
pmy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pmen_0071
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pmen_0071
Enzymes [BR:pmy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pmen_0071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABP82845
UniProt: A4XNC9
Position
complement(68382..69617)
Genome map
AA seq 411 aa AA seqDB search
MTAMPGSQNSFRTGPDARGLFGRFGGQFVAETLMPLINSLAAEYEKAKSDPAFLEELAYF
QRDYIGRASPLYYAERLSQHFGGAKIYLKREDLNHTGAHKINNCIGQILLAKRMGKQRII
AETGAGMHGVATATVAARFGMQCVVYMGTTDIDRQQANVFRMKLLGAEVIPVTAGTGTLK
DAMNEALRDWVTNVHNTFYLIGTAAGPHPYPAMVRDFQSVIGNEVREQILAKEGRLPDSL
VACIGGGSNAIGLFHPFLDDEGVQIIGVEAAGHGIDTGKHAASMAGGAPGVLHGNRTFLL
QDEDGQITDAHSISAGLDYPGVGPEHAWLHEIKRVEYVPISDDEALEAFHHCCRLEGIIP
ALESAHALAEAFKRAPKLPKDHLMVINLSGRGDKDMQTVMHHMQDNQEKHA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgacagccatgcctggttcacagaattctttccgcaccggccccgacgctcgcggcctg
ttcggccgcttcggcggtcagttcgtcgccgaaaccctgatgccgctgatcaactcgctg
gccgccgaatacgaaaaggccaagagcgatccggccttcctcgaagaactggcctacttc
cagcgcgactacatcggtcgcgccagcccgctttactacgccgagcgcctgagccagcac
ttcggcggcgcgaagatctacctcaagcgcgaagacctgaaccacaccggcgcgcacaag
atcaacaactgcatcggccagatcctcctggccaagcgcatgggcaagcagcgcatcatc
gccgagaccggcgccggcatgcacggcgtggccaccgccaccgtggccgcgcgcttcggc
atgcagtgcgtggtgtacatgggcaccaccgacatcgaccgccagcaggccaacgtcttt
cgcatgaagctgctcggcgccgaggtaattccggtcaccgccggcaccggcaccctcaag
gacgccatgaacgaggccctgcgcgactgggtgaccaacgtccacaacaccttctacctg
atcggcaccgccgccggcccgcacccgtacccggccatggtccgcgacttccagtcggtg
atcggcaacgaagtgcgtgagcagatcctggcgaaggaagggcgtctgcccgactcgctg
gtggcctgcatcggtggtggctccaacgccatcggcctgttccaccccttcctcgatgat
gaaggcgtgcagatcatcggcgtcgaggcggccggccacggcatcgacaccggcaagcat
gcggcgagcatggccggcggcgcgccgggcgtgctgcacggcaaccgcaccttcctgctg
caggacgaggacggccagatcaccgatgcccactcgatttccgccggcctcgattacccc
ggcgtcggcccggaacacgcctggttgcacgagatcaagcgcgtcgaatacgtgccgatc
agcgatgacgaagccctcgaagccttccaccactgctgccgcctggaaggcatcatcccg
gccctggaaagcgctcatgcgctggccgaagccttcaagcgtgcgccgaaactgcccaag
gatcacctgatggtgatcaacctgtccggtcgtggcgacaaggacatgcagaccgtgatg
caccacatgcaggacaaccaggagaaacacgcatga

DBGET integrated database retrieval system