KEGG   Pseudomonas mendocina ymp: Pmen_0093
Entry
Pmen_0093         CDS       T00510                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pmy  Pseudomonas mendocina ymp
SSDB
Motif
Pfam: PAAR_motif FlgD_ig
Other DBs
NCBI-ProteinID: ABP82867
UniProt: A4XNF1
Position
88331..89776
AA seq 481 aa
MSGKPAARLGDPTACPIPGHGTNPIAAGSPDVLFDSLPAARMGDASACGGAMAGAVIPNV
LINGKPAAVVGSVGSHGNTVVAGSGTVLIGASGGGAAFSPVAPLSLVAAAASVINVLVPP
AQAAEERALDYTIALQRGGNRVLTPLRIPDYEEIGQGTTNNRETIDFQIRNRKQPADSLT
LEVYDGETLLHSEADTAALLPTGEHQWQWDGYDRSGVLDTRVLKSPNLLVRLTVKKGAEE
QVSELRLDNSAAAAPWVDARVDRNAGSVEITLRPSFSDGGVSGRNNQLTARTFDELKVLA
KAGVEYYWSREGSRAGGIDKPIQTAKGAFQVKVIADVNAKPSAKNFPLIASIGDDFGRST
SFAMFKKIYHNLGMWAAANYPANFADEDFAHTAAHEVGHLILNEYGDGGLIPAYSWSHKS
TSTILTQAPVDNHPIPAAGEIDLMHYHSHSPRNYQDYWQRSIASENDVKGLLWLTRVKFD
D
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgtccggtaaacccgcagcccgcctcggcgatcccaccgcctgcccgattcccggccac
ggcaccaacccgatcgccgccggctcgcccgacgtgctgttcgacagtctgcccgccgcg
cgcatgggcgatgcctccgcctgcggcggcgccatggccggcgcggtgattcccaacgtg
ctgatcaacggcaagccggcggcggtagtgggcagtgtgggcagtcatggcaataccgtg
gtggctggctccggcaccgtgttgatcggcgcgagtggcggtggggcggcgttcagcccg
gttgcgccgctgtcgctggtggctgctgcagctagcgtcatcaatgttctggtgcctccg
gctcaagcggccgaagagcgcgcgctggattacaccattgctttgcagcgtggaggcaat
cgtgtgctcacgcctctgcggattcccgattacgaggaaattggacaaggcacaacgaac
aatcgagagaccatcgatttccagatccgtaaccgcaaacagccggccgatagcctgacc
ctggaggtatacgatggcgagacgctgctccatagcgaagcggatacagcggcgctgctt
ccgacaggtgagcaccagtggcagtgggacggctacgaccgatctggcgttctcgatact
cgtgttttgaaaagccccaacctgcttgtgcgtctgaccgtgaagaaaggtgctgaagag
caggtatcggagctgcggctggacaatagcgctgcagccgcaccgtgggtcgatgcccgc
gttgatcgcaacgctggctccgtcgagatcaccctgcgccccagcttctctgatggtggt
gtatccggcaggaacaaccaattgacggcccgcacattcgatgaactgaaggtattggcc
aaggcgggggtcgaatactactggtcgcgtgagggcagtcgtgcaggcggcatcgacaag
ccgattcagacagccaaaggcgcgtttcaggtgaaggtcatcgctgatgtgaatgccaag
cccagcgccaagaatttcccgctcattgcttcaatcggtgatgacttcggtcgttccact
agtttcgcgatgttcaaaaagatttaccacaacttgggcatgtgggcggctgccaactat
cccgccaattttgccgatgaggatttcgcgcacaccgctgcgcatgaggtgggtcacctc
atcctcaacgagtacggcgatggtggcttgatacctgcgtactcgtggagccacaagtcg
acctccacgatcctcactcaggcgcctgtggacaatcaccccattccagcggcaggggag
atagaccttatgcattaccactcccacagcccacgcaactaccaggactattggcagcgt
tccatcgcctcggagaacgacgtcaagggcctgttgtggcttacccgggtgaaattcgat
gactaa

DBGET integrated database retrieval system