KEGG   Pseudomonas mendocina ymp: Pmen_0107
Entry
Pmen_0107         CDS       T00510                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pmy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pmen_0107
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmy02044]
    Pmen_0107
Secretion system [BR:pmy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pmen_0107
SSDB
Motif
Pfam: Phage_GPD Phage_base_V DUF2345
Other DBs
NCBI-ProteinID: ABP82881
UniProt: A4XNG5
Position
106434..108515
AA seq 693 aa
MLNPANETHFSLTIEGVEHDLQVLEFNGREAISQPYRFDVELISERPDLDLTSLLHQRAF
LAFSPNGDGIHGLIHRVEQGESGKRLTRYRLAIVPQLAYLAHRTNQRIFQHLTVPQIIAQ
VLEEHGIVEGRYQFQLGPSVYPQREYCVQYDESDLHFVQRLCEEEGIHYHFQHSASGHVL
TFGDDQTAFAKLGQPTPYIQDSGMTADDPVIKRLALRLETRTRSTARRDYDFEQPRLLLE
AAYQGEQAGENDGLPDLEDYDYPGRYTDRTRGKHLAKRALERHRADYQQLQGQSDQPRLV
TGHLLEISEHPRREWNDLWLLTEVLHEGKQPQVLEESVLNLPSPPGRGAGGEGTSGDTDF
TQGYRNRFLATPWDVPFRPPLVHPKPRVLGSQSAVVTGPAGEEIHCDEYGRVKVQFFWDR
EGQADEKTSCWLRVSSSWAGDRYGAITIPRIGMEVLVTFLEGDPDQPLVTGCLYHAEHLV
PYDLPANKTRSVFKTLSSPGGGGYNELRIEDRKGAEQIYIHAQRNWDENIEHDQKIRVGN
ERHDTVEKNSYTELLAEEHLTVTADRKVEVKPQDHLTVATDQHIKLGTAQLTKAGREIHL
KAGQKMVIEAGIELTIKAGGSFIKLDPGGITISGPLARINAGGSPGKGSGLKIKPPVLPG
MADSDKAGSLLEQAVGNALTPKAKPKRTLNFSG
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgttgaacccggccaatgaaacccatttcagcctgaccatcgaaggcgtcgagcacgat
ctgcaggtgctcgaattcaacggccgcgaggccatcagccagccctatcgcttcgacgtc
gagctgatcagcgaacgcccggatctcgatctgaccagtctgctgcatcagcgcgccttc
ctcgccttcagccccaatggcgacggcatccacggcctgatccaccgggtcgagcagggc
gagtccggcaaacgcctgacccgctatcgcctggccatcgtgccgcagctcgcctacctg
gcgcaccgcaccaaccagcgcatcttccagcacctgacggtgccgcagatcatcgctcag
gtgctggaagaacatggcatcgtggagggccgctaccagttccagctaggccccagcgtc
tacccgcagcgcgagtactgcgtgcagtacgacgagagcgacctgcacttcgtccagcgc
ctgtgcgaggaagaaggcatccactaccacttccagcacagcgcaagcggccatgtgctg
accttcggcgacgaccagaccgccttcgccaagctcggccagcctacgccctatatccag
gacagcggcatgaccgccgacgatccggtgatcaagcgcctggccctgcgcctggaaacc
cgcacccgcagcaccgcccgccgcgactacgacttcgagcagccgaggctgctgctggag
gcggcctaccagggcgagcaggccggcgaaaacgacggcctgcccgatctggaagactac
gactaccccggccgctacaccgaccgcacgcgcggcaagcacctggccaaacgcgccctg
gagcgccaccgcgccgactaccagcaactgcaaggccagagcgaccagccgcggctggtt
acggggcatctgctggaaatctccgaacacccgcgccgcgaatggaacgacctctggctg
ctcaccgaagtgctgcacgaaggtaaacagccgcaggtgctggaggagtcggtgttgaac
ctcccctctccccccgggagaggggccgggggtgagggtacttcaggcgacaccgacttc
acccaaggctaccgcaaccgctttctcgccaccccctgggacgtgcccttccgaccgccc
ttggtccaccccaaaccgcgcgtcctcggcagccagagcgccgtggtcacgggccctgcc
ggcgaggaaatccactgcgacgaatacggtcgagtgaaggtgcaattcttctgggatcgc
gaaggccaggccgacgagaagaccagctgctggctgcgcgtcagctccagctgggctggc
gatcgctacggcgccatcaccatcccgcgcatcggcatggaagtgctggtcaccttcctc
gaaggcgaccccgatcaaccgctggtcaccggctgcctctaccacgccgaacacctggtg
ccctacgacctgccggcaaacaagacccgcagcgtgttcaagaccctgagcagccctggc
ggtggcggctacaacgaactgcgcatcgaggatcgcaagggcgccgagcagatctacatc
cacgcccagcgcaactgggacgagaacatcgagcacgaccagaagatccgcgtcggcaac
gaacgccacgacaccgtggagaagaacagctacaccgaattgctggccgaggagcacctc
accgtcaccgccgaccgcaaggtcgaggtcaagccccaggaccacctgacggtggccacc
gaccaacacatcaagctgggcaccgcgcaactgaccaaggccggccgcgagatccacctg
aaggccgggcagaagatggtcatcgaagccggcatcgaactgacgatcaaggccggcggc
agctttatcaaactcgaccccggcggcatcaccatctccggcccgctggccaggatcaac
gccggcggttcgccaggcaagggctcggggctcaagatcaaaccgccggtgctgccgggt
atggcggatagcgacaaggcggggagtttgttggagcaggcggttggtaatgcgctgacg
cccaaggcaaaacccaaacgcacgctgaacttctccggttaa

DBGET integrated database retrieval system