KEGG   Pseudomonas mendocina ymp: Pmen_0120Help
Entry
Pmen_0120         CDS       T00510                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00010  Glycolysis / Gluconeogenesis
pmy00071  Fatty acid degradation
pmy00350  Tyrosine metabolism
pmy00625  Chloroalkane and chloroalkene degradation
pmy00626  Naphthalene degradation
pmy01100  Metabolic pathways
pmy01110  Biosynthesis of secondary metabolites
pmy01120  Microbial metabolism in diverse environments
pmy01130  Biosynthesis of antibiotics
pmy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmen_0120
  Lipid metabolism
   00071 Fatty acid degradation
    Pmen_0120
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pmen_0120
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pmen_0120
   00626 Naphthalene degradation
    Pmen_0120
Enzymes [BR:pmy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pmen_0120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C TrkA_N 2-Hacid_dh_C Urocanase adh_short_C2
Motif
Other DBs
NCBI-ProteinID: ABP82894
UniProt: A4XNH8
Position
119556..120578
Genome map
AA seq 340 aa AA seqDB search
MNPTMKAAVVHAFGQPLRIEEVKTPLPGPGQILVKIEASGVCHTDLHAAEGDWPVKPSLP
FIPGHEGVGYVAAVGSGVTRVKEGDRVGVPWLYSACGCCEHCLTGWETLCESQQNTGYSI
NGGYAEYVLADPNYVGILPKNVDFLEIAPILCAGVTVYKGLKETRARPGQWVVISGIGGL
GHVAVQYARAMGLHVVAVDVDDAKLELARRLGASLTINARQENPAEVVQREIGGAHGVLV
TAVSNAAFGQAIGMARRHGTVALVGLPPGDFPTPIFDVVLKAISITGSIVGTRADLQEAL
DFAGEGLVRATVHSDRLDNINAIFEQMRQGQIEGRMVLQF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgaccatgaaagccgcagtggtccacgccttcggccagccgctgcgtatcgag
gaggtgaaaaccccgctacccggcccggggcagattctggtgaagatcgaggcttccggc
gtctgccacaccgacctgcacgcagccgagggcgactggccggtgaagccgagcctgccg
ttcattcccggccatgaaggggttggctacgtggcggcggtcggcagcggcgtgacccgg
gtcaaggagggcgaccgtgtcggcgtgccctggctgtacagcgcctgtggctgctgcgag
cactgcctgaccggctgggagacgctttgcgagagccagcagaacaccggctactcgatc
aacggcggctatgccgagtacgtgctggctgaccccaactacgtcggcatcctgccgaag
aacgtcgacttcctcgagatcgcgccgatcctctgtgccggggtgacggtgtacaagggc
ctcaaggaaaccagggcgcggcccggccagtgggtggtcatctccggtatcggcggcctc
ggtcacgtcgccgtgcagtacgcccgcgccatgggcttgcacgtggtcgcggtggatgtc
gacgacgccaagctggagctggcgcgcaggctcggcgccagcctgaccatcaacgcacgc
caggaaaacccggccgaggtggtgcaacgcgagatcggcggcgcccacggtgtgctggtt
accgcggtgtccaacgccgccttcggccaggccatcggcatggcgcgtcggcacggtacg
gtggccctggtcggcctgccgccgggcgacttccccacgccgatcttcgatgtggtgctc
aaggccatcagcatcaccggctccatcgtcggcacccgcgccgatctgcaggaggcgctg
gacttcgccggcgaaggcctggtcagggccacggtgcacagcgacaggctggacaacatc
aatgccatcttcgagcagatgcgccaggggcagatcgagggacgcatggtgctgcagttc
tag

DBGET integrated database retrieval system