KEGG   Pseudomonas mendocina ymp: Pmen_0519Help
Entry
Pmen_0519         CDS       T00510                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00340  Histidine metabolism
pmy01100  Metabolic pathways
pmy01110  Biosynthesis of secondary metabolites
pmy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Pmen_0519
Enzymes [BR:pmy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     Pmen_0519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH
Motif
Other DBs
NCBI-ProteinID: ABP83289
UniProt: A4XPM3
Position
complement(555607..555942)
Genome map
AA seq 111 aa AA seqDB search
MSDTLSRLAEVLEARKGAAPDSSYVASLYHKGLNKILEKVGEESVETILAAKDAAASGDC
KDLIYETADLWFHSLVMLAALGQHPQAVLDELDRRFGLSGHAEKAARPQSE
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaccctgagccgcctggccgaggtactggaagcgcgcaagggtgcagcgccc
gacagctcctacgtcgccagcctgtatcacaagggcctgaacaagattctggaaaaggtc
ggtgaggaatcggtggaaaccatcctcgccgccaaggacgccgccgccagcggcgactgc
aaggacctgatctacgaaaccgccgacctgtggttccacagcctggtcatgctcgccgcc
ctcggccagcatccgcaggccgtgctggacgaactggatcgccgtttcggcctctccggc
cacgcggaaaaagccgcgcgaccgcaatcggaataa

DBGET integrated database retrieval system