KEGG   Pseudomonas mendocina ymp: Pmen_0693Help
Entry
Pmen_0693         CDS       T00510                                 

Definition
(GenBank) urease, beta subunit
  KO
K01429  urease subunit beta [EC:3.5.1.5]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00220  Arginine biosynthesis
pmy00230  Purine metabolism
pmy00791  Atrazine degradation
pmy01100  Metabolic pathways
pmy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Pmen_0693
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Pmen_0693
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    Pmen_0693
Enzymes [BR:pmy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     Pmen_0693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Urease_beta
Motif
Other DBs
NCBI-ProteinID: ABP83461
UniProt: A4XQ45
Position
complement(766605..766910)
Genome map
AA seq 101 aa AA seqDB search
MIPGQYQIADGEIELNAGRRTLTLSVANSGDRPIQVGSHYHFFETNDALIFDRASTRGMR
LNIPAGTAVRFEPGQSREVELVDLAGARRVFGFAGRVMGDL
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgattcccggccaataccagattgccgatggcgagatcgagctcaatgccggccgccgc
accctgaccctgtccgtggccaacagtggcgaccggccgattcaggttggctcgcactac
cacttcttcgagaccaacgatgcgctgatcttcgatcgagcatccacgcgaggcatgcgc
ctgaacattcccgccggcactgcggtgcgcttcgagccggggcagagccgtgaggtggaa
ctggtcgatctggccggcgcgcgccgggtgttcggcttcgccggccgggtgatgggcgat
ctttga

DBGET integrated database retrieval system